KEGG   Edwardsiella hoshinae: A9798_10165Help
Entry
A9798_10165       CDS       T04508                                 

Definition
(GenBank) peptidoglycan synthase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00550  Peptidoglycan biosynthesis
eho01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A9798_10165
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A9798_10165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eho01011]
    A9798_10165
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eho03036]
    A9798_10165
Enzymes [BR:eho01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A9798_10165
Peptidoglycan biosynthesis and degradation proteins [BR:eho01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A9798_10165
Chromosome and associated proteins [BR:eho03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    A9798_10165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AOV98586
UniProt: A0A376DIR9
LinkDB All DBs
Position
2297155..2298903
Genome map
AA seq 582 aa AA seqDB search
MRKKSPQNVRANYFSGRFVLIYIGIAVFLLLLLLRVGYLQLMKQPQLEKEADQRSLRELV
THPLRGTITDRNGQPLAVSVASNDVIADPLRVLQHDPQLSSPQWRYLASALSQPLDSLRD
KIRQNSQRRFIYLGRQVEAEIADYIAKLHITGIATPSDASRYYPMGAAAAPLLGIVGLDQ
QGLNGIEHGFNALLQGKPGYRLYRKDRYGHVVGLMEDDPAQQAPTLALSIDRYLQYALYS
HLRDGVLRNQADSGAAVLVDVNTGEILGMASYPSFNPNNYQGVAQQDMRNVAISDSFEPG
STVKPLVVMAGLQRHLIRPDSVIDTTPYPVNGHLIRDVGHWPRLTITGILQKSSDIGVSH
IALAMPADVLVNLYHGFGLGVSTALGISGESSGYFPLHRQRWSDIERATFSFGYGLRITP
LQMAREYATIGAFGLFRPLSITKVTPPVIGTRVIDADIVRTVVHMMESDALPGGSGVAAA
VPGYRLAIKTGTAEKMGSDGKYDGGYINYTAGVAPASNPRVALVVMINHPTAGKHFGGSV
AGPVFGQIMGDVLRHMNIPPDALTDQAITLNRNSEVMQHPGT
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaaaaagccctcagaacgttagagccaactatttttccggccgctttgtgctg
atctatatcggcatcgctgtttttctcctgttactgctgttgcgcgtcggctatctccaa
ttaatgaaacaacctcagttggaaaaagaggccgaccaacgttcgctacgcgagctggta
acacatccgttgcgcggtaccatcaccgaccgcaacggtcagccactggccgtcagcgtc
gcctccaacgatgtgatcgccgatccgctacgcgtcctacagcacgacccgcagcttagc
agtccgcaatggcgctatctggcgagcgccctttcccaaccgctggatagcctgcgcgac
aagatccggcaaaacagtcaacggcgcttcatctacctcggccggcaggtagaggcggaa
atcgctgactatatcgctaagttgcatatcaccggcatcgccacccccagcgatgcgagc
cgctactacccgatgggggctgcggcagcgcccttgctcggcatcgtggggctcgatcag
cagggcttgaatggtatcgaacatggtttcaacgccttattacagggaaagcccggttat
cgtctataccgcaaagatcgctacggccatgtggtcggcctgatggaggatgatccggcg
cagcaagcaccaaccctggcactgagtatcgaccgctatcttcaatacgccctttactcc
cacctgcgcgatggcgtgctgcgcaaccaggcagactccggcgccgccgtactggtggac
gtcaatacaggcgaaatcctagggatggcaagttacccctcgtttaatcccaataactac
cagggagtggcgcagcaagatatgcgtaacgtcgccatctccgatagcttcgagcccggc
tccacggtgaaaccgctggtggtgatggccggactccaacgccatctgatccgcccggat
tcggtcatcgacaccacgccctatccggtcaacggccacctgatccgcgacgttggccac
tggccgcgcctgaccatcaccggtatcctacaaaagtcgagcgacatcggcgtctcgcac
atcgcgctcgcgatgccagccgatgtgctggtcaatctgtaccatggttttggcctgggc
gtatcgaccgcactggggatcagtggcgagagcagcggctacttccctctgcatcggcaa
cgttggtcggatatcgagcgtgcgaccttttccttcggctatggcctacgcatcacaccg
ttacagatggcgcgtgaatacgcgaccatcggcgcctttggtctatttcgtcccttatcg
atcaccaaagtgaccccgccggtgatcggcacccgggtgatcgatgcagacatcgtacgc
accgtggttcatatgatggagagcgacgccctccccggcggcagcggcgtggcagcggcc
gtgcctggctaccgtctggcgatcaagaccgggaccgccgagaagatgggtagcgacggc
aagtacgatggcggctatatcaactataccgcgggcgtagcgccagcgagcaatccacgc
gtcgccctggtggtgatgatcaaccacccgaccgccggcaaacacttcggcggctcggtc
gccggcccggtattcggtcaaatcatgggggacgtactgcgccacatgaatattccgccc
gatgccctaaccgatcaggccatcaccctcaaccggaatagcgaagtgatgcaacatcct
ggtacataa

DBGET integrated database retrieval system