KEGG   Edwardsiella hoshinae: A9798_10390Help
Entry
A9798_10390       CDS       T04508                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00061  Fatty acid biosynthesis
eho01100  Metabolic pathways
eho01212  Fatty acid metabolism
Module
eho_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9798_10390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:eho01004]
    A9798_10390
Enzymes [BR:eho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A9798_10390
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     A9798_10390
Lipid biosynthesis proteins [BR:eho01004]
 Fatty acid synthase
  Component type
   A9798_10390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AOV97328
UniProt: A0A376DHP6
LinkDB All DBs
Position
2346809..2347327
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKADLEASGRGELFGAGGPPLPSGNMLMMDRVIKMTEDGGNHNKGYVEAELD
ITPDLWFFACHFVGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRVINRKLIMGLADGEVFVDGKLIYTASDLKVGLFKDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctacacaaaggcggatctggaagcatcgggtcgtggtgag
ctgttcggcgcaggcggaccgccgctgccatcaggcaatatgctgatgatggatcgcgtc
atcaagatgacggaagatggcggtaaccacaacaagggttacgtggaagcagaactggat
atcacgccggatctgtggttctttgcctgtcatttcgtcggcgatccggttatgccgggc
tgcctcggtctggatgccatgtggcaattggtcggcttctatctcggttggctgggtggc
gaaggtaaaggtcgcgcgctgggcgttggtgaagtcaagttcaccggccaagtactgccg
acggcgaaaaaggtcacctaccgtatccacttcaagcgcgttatcaaccgcaaactgatc
atgggtctggcggatggcgaggtgttcgtcgacggtaagctgatctataccgccagcgac
ctcaaagttggtctgttcaaagacaccagcgccttctaa

DBGET integrated database retrieval system