KEGG   Edwardsiella hoshinae: A9798_16650Help
Entry
A9798_16650       CDS       T04508                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00620  Pyruvate metabolism
eho00680  Methane metabolism
eho01100  Metabolic pathways
eho01120  Microbial metabolism in diverse environments
eho01200  Carbon metabolism
Module
eho_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9798_16650
  09102 Energy metabolism
   00680 Methane metabolism
    A9798_16650
Enzymes [BR:eho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A9798_16650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOV98410
UniProt: A0A1D8N2D9
LinkDB All DBs
Position
3729847..3732480
Genome map
AA seq 877 aa AA seqDB search
MNEQYSAMRGNVSMLGKLLGDTIKDALGEQILDRVETIRRLSKSSRAGNEASRQALLNTL
QNLSNDELLPVARAFSQFLNLANVAEQYHRISPHGEAASNPDALSQLFTRLKKKNLDENQ
IRQAVDNLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHDDLADYERHQIMRRLRQL
VAQSWHTDEIRKNRPTPIDEAKWGYAVVENSLWEGVPAFLREFNEQLEKALGYQLPVEAV
PVRFTAWMGGDRDGNPNVTAEVTRRALLLSRWKATELFLRDVQVLVSELSMTVCTPELRV
LAGEEAQEPYREVLKRLRRQLVDTQTYLDARLRGERPPRPHDLLVNNDQLWQPLHTCYRS
LIACGMGIIANGQLLDTLRRVHCFGVPLVRIDIRQESTRHTEAIAELTRYLGLGDYETWS
EADKQAFLLRELNAKRPLVPRHWTPSPETKEVFDTCQVIAEAPAGAIAAYVISMARTPSD
VLAVHLLLKEAGCPFNLPVAPLFETLDDLNNAEAVMSQLLSIDWYRGFIQGKQMVMIGYS
DSAKDAGVMAASWAQYRAQEALVRVCDQAGIALTLFHGRGGSIGRGGAPAHDALLSQPPG
SLKGGLRVTEQGEMIRFKLGLPEIAVSSLTLYTSAILEANLLPPPAPKQAWRDIMDELSQ
TSCALYRRYVRENPDFVPYFRSATPELELGKLPLGSRPAKRRPTGGVESLRAIPWIFAWT
QNRLMLPAWLGAGAALTEAMEHGKRDTLESMYRDWPFFTTRIDMLEMVFAKSDLWLAEYY
DQRLVDPALWPLGTDLRQQVQRDIQAVLAIANTDHLMADLPWAAESIALRNVYTDPLNVL
QAELLHRSRQQETPDANVEQALMVTIAGVAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcaatattcagcaatgcgtggcaatgtcagtatgttgggcaaactgctgggc
gataccatcaaagacgcgctaggcgaacaaatcctagatcgcgtcgaaaccatccgcagg
ctgtccaagtcgtcacgcgctggcaatgaagccagtcgtcaggcgttgctgaacacactg
caaaacctgtccaacgatgagctactaccggtggctcgtgccttcagccagttccttaat
ctggctaacgtggcggagcaataccatcgtatttctccgcatggcgaggccgctagcaac
cccgatgccctctctcagttattcacccggttgaagaagaaaaacctggatgagaaccag
atccgtcaggccgtcgacaacctctctattgagctggtattgaccgcacatccgaccgag
atcacccgccgcaccttgatccataaactggtcgaggtcaacacctgcctcagccaactt
gaccacgacgatctggccgattacgaacgtcatcaaatcatgcgtcgcctacgccaactg
gttgcgcagtcctggcacaccgacgagattcggaagaaccgtccgaccccgatcgatgaa
gcgaagtggggctatgctgtcgtcgaaaatagtctgtgggaaggggtacccgccttcctt
cgcgaattcaacgagcagttagaaaaagcgctcggttaccaattgccagtcgaggccgta
ccggtacgctttaccgcctggatgggcggcgaccgtgacggtaaccccaacgtcaccgcc
gaggtgacgcgccgcgccctgttgctcagccgctggaaagccaccgaactcttcctacgt
gacgttcaagtgctggtatcagagctatccatgacagtctgtactccagagttacgagtt
ctggctggcgaggaggctcaagagccttaccgcgaggtattgaaacgcctgcgccgccag
ttagtcgatacccaaacctatctcgatgcccgtctacgcggcgaacgcccacctcgtccg
catgacctgctggttaataacgatcagctatggcaaccactacatacctgctaccgctca
ctcatcgcctgcgggatggggatcatcgccaatggacagctgctggacaccctgcgccga
gtgcattgcttcggtgtcccactggtgcgtatcgatatccgccaagagagtacgcgtcac
accgaggctatcgccgaactgacacgttacctggggctgggcgactatgaaacttggtca
gaggcagacaagcaagcgttcttgctgcgtgagctaaacgccaaacgcccactggttccg
cgccactggacgccatcaccggagactaaagaggtcttcgatacctgccaggtgatcgcc
gaggcgccagccggggccatcgcagcctacgtcatctccatggcacgtacaccttcggat
gttttggcggtacacctactgctgaaagaagccggctgccccttcaacctcccagtggca
ccgctatttgaaaccctcgatgatctaaacaatgccgaggcggtaatgagccaattgctc
agcatcgactggtatcgcggtttcatccagggcaagcagatggtgatgatcggttattcc
gactccgccaaagatgccggggtgatggcggcatcctgggctcaataccgcgcacaagaa
gcactggttcgtgtctgcgaccaggcggggatcgccctaaccctgttccatggccgtggc
ggctctatcggccgcggcggtgcgccagcgcatgatgccctgctctctcagcctccgggt
agcctgaaaggtggcctgcgcgtcaccgagcagggagagatgatccgctttaagctcggt
ttgcccgagatcgccgtcagcagcctgaccctatataccagcgccattctggaggccaat
ctgctaccaccaccagccccgaaacaggcctggcgcgacattatggacgagctttctcaa
acctcctgtgcgctctaccgtcgctatgtgcgcgagaatcccgacttcgtcccctatttc
cgctcggcgacaccagagctggaactgggcaagttacccttgggctcccgcccagccaaa
cgccgtcccaccgggggcgtcgaaagcctgcgcgccattccctggatcttcgcctggaca
cagaatcgcctgatgctaccggcctggctgggtgccggcgccgcgctgacggaggcgatg
gagcacggaaaacgcgacacgctagaaagcatgtaccgcgactggcctttcttcactacc
cgtatcgacatgctggagatggtgttcgccaaatctgatctgtggctggcggagtactat
gaccaacggctggtcgacccggcattgtggccgctgggcaccgatctccgtcaacaggta
caacgcgacatccaagcagtgctggccattgccaacaccgaccatctgatggctgatctg
ccttgggccgccgagtccatcgccctacgtaacgtctataccgatccactcaacgtcttg
caagccgagctactgcatcgctcacgccaacaggagacgccagacgctaacgttgaacaa
gcgctgatggtcaccatcgctggggttgccgccgggatgcgtaacaccggctag

DBGET integrated database retrieval system