KEGG   Enterococcus hirae: EHR_00025Help
Entry
EHR_00025         CDS       T02160                                 

Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ehr  Enterococcus hirae
Brite
Enzymes [BR:ehr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EHR_00025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFM69002
UniProt: I6SUE6
LinkDB All DBs
Position
complement(3925..4533)
Genome map
AA seq 202 aa AA seqDB search
MTYTLPDLPYAFDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKHPELGEKTIEELLSD
MDAVPTDIKTAVRNNGGGHANHSFFWKIMAPNAGGEPTGAIKEAIDETFGDFATFKEEFK
KAAAGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRPD
YIEAFWNVVNWEEVNNRLSSAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacattaccagatttaccatatgcattcgatgcgttagaaccttatatcgat
gaagaaacgatgcacttgcatcatgacaaacaccataatacttatgtaacaaatttaaat
gcagcgattgaaaaacatccagaactaggtgaaaaaacaatcgaagaactactttctgat
atggatgctgtccctacagatatcaagactgctgtacgtaataatggtggcggacatgca
aaccattctttcttctggaaaatcatggcaccaaatgctggtggcgaaccaactggtgca
attaaagaagcgattgatgaaacctttggtgattttgcaacatttaaggaagaatttaaa
aaagctgcagctggccgttttggttcaggttgggcttggttagtgatggaaaatggtaaa
ttagcgatcacttcaacagccaatcaagattcaccattaatggaaggcaaaacacctatt
ttaggtttagatgtttgggaacatgcgtattatttgaaatataagaatgtacgacctgat
tacattgaagctttctggaacgttgtgaactgggaagaagtaaacaatcgattatcatct
gccaaataa

DBGET integrated database retrieval system