KEGG   Enterococcus hirae: EHR_01990Help
Entry
EHR_01990         CDS       T02160                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ehr  Enterococcus hirae
Pathway
ehr00240  Pyrimidine metabolism
ehr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EHR_01990
Enzymes [BR:ehr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EHR_01990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 DUF4371 KdpD AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AFM69382
UniProt: I6SVF9
LinkDB All DBs
Position
complement(370534..371118)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAHNYEEQNKPVVLMTSGIDTRDGVGVVSSRIGLKREAT
PIFEETDVFDVIFQMEDKPYCILIDEAQFLKKKHVIAFTKIVDELNIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCHKKAIMNLHYIDGQPVYEGDQVQIGGNEAYYPVC
RKHYFEPSIMTEGE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactattttttaagtatggcgcaatgaatagcggcaagacaattgagatctta
aaagtcgcacataattatgaagaacagaataaaccagttgtcttgatgacaagtgggatc
gataccagagatggtgttggtgttgtctctagtcgtattgggttaaaaagagaagccacg
ccgatttttgaagaaacagatgtctttgatgtcatttttcaaatggaggataagccatat
tgtatattgatcgacgaggcgcaatttttaaagaaaaaacacgtaattgcgtttacgaaa
attgttgatgaattaaacattccggtgatggcatttggtttgaagaatgattttagaaat
gagttatttgaaggatcaaaatatctattgctttatgcagacaaaatcgaagagatgaaa
acgatctgctggttctgccataagaaagcaatcatgaatttacattatatcgatggtcaa
ccagtttacgagggggatcaggtacaaattggtggaaatgaagcctattaccccgtttgt
cggaaacactattttgaaccatcaattatgacagaaggagaataa

DBGET integrated database retrieval system