KEGG   Enterococcus hirae: EHR_04265Help
Entry
EHR_04265         CDS       T02160                                 

Definition
(GenBank) iron ABC transporter permease
  KO
K02015  iron complex transport system permease protein
Organism
ehr  Enterococcus hirae
Brite
KEGG Orthology (KO) [BR:ehr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ehr02000]
    EHR_04265
Transporters [BR:ehr02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    EHR_04265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3
Motif
Other DBs
NCBI-ProteinID: AFM69823
UniProt: I6SB60
LinkDB All DBs
Position
complement(808025..808975)
Genome map
AA seq 316 aa AA seqDB search
MRYGWLIGLLGLLTISSLFIGVSTIQVIDLLQFKGQSTQLFLATRLPRTVCLILAGATSS
ICGLIMQHLTQNKFVSPTTAGTMDSARLGILVVMLFLPNAPLLLRSFTAFLFAFGGTLLF
LFLAQTLPQKNQLMLPLIGVMLGNIIGSIATFFAYQFQLIQNMSSWLQGNFATIIRGNYE
LLYVTVPLLIVISFFAYRFTIVGLGESFAVNLGIDYKKMQLLGIGLVSLASAIVLIMVGS
IPFLGVIIPNITARLYGDQVHKTIGITALLGSVFLLFCDIVARLVIYPYEIPVSVIVGIF
GAIIFLYLLVRRKKYA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacggttggctcatagggttgttaggtttactgactatcagctcattatttatt
ggtgtctcaacgattcaagtaattgatttgcttcaattcaaaggacaaagcacgcaattg
tttcttgccactcgtctgccacgaacggtttgcctgatccttgcaggagcaactagcagt
atttgtggcttgatcatgcaacatttgacgcaaaataaatttgtttcgcctaccacagct
ggaacgatggatagtgcaagattgggtattttagtggtgatgctttttttaccaaatgca
ccgttgcttttacgttcatttaccgcttttttgtttgcttttggtgggacacttttattt
ctttttttggcacaaacgttacctcaaaagaatcaactgatgttaccattgatcggtgtc
atgttaggtaatatcatcggctccattgccactttttttgcttatcaatttcaattgatc
caaaatatgtcttcttggttacaggggaattttgccacgattatacgtggaaattatgaa
ttgctttatgtaaccgttccattattaatcgttatttctttctttgcttatcgatttacg
attgttggattgggggagtcatttgcggtcaatttagggattgactataaaaaaatgcag
ttactagggatcggtctcgtttctttggctagtgcgattgttttgatcatggtgggaagt
attccatttttaggggtaatcattccaaatatcacagcccgtttatatggagatcaagta
cataaaacaattggtattactgcattgttgggaagtgttttcttacttttttgtgatatc
gttgctcgcttggtgatctatccttacgaaatcccagtaagtgtgatcgtgggaatcttc
ggggctattatttttctctatttgttggttaggaggaaaaaatatgcttaa

DBGET integrated database retrieval system