KEGG   Enterococcus hirae: EHR_05700Help
Entry
EHR_05700         CDS       T02160                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ehr  Enterococcus hirae
Brite
KEGG Orthology (KO) [BR:ehr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ehr01001]
    EHR_05700
Enzymes [BR:ehr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EHR_05700
Protein kinases [BR:ehr01001]
 Serine/threonine kinases: Other
  Bacterial family
   EHR_05700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Kinase-like Kdo RIO1 Seadorna_VP7 DUF4366 Pox_ser-thr_kin FTA2 CrgA
Motif
Other DBs
NCBI-ProteinID: AFM70091
UniProt: I6T5X0
LinkDB All DBs
Position
1091043..1093076
Genome map
AA seq 677 aa AA seqDB search
MIELGKKLNGRYQITGNIGSGGMANVFLAHDLILDRDVAVKVLRFDFQNDQTAIRRFQRE
ALAATELVHPNIVSVYDVGEEDNMQYLVMEYVKGMDLKRYIQTHYPVPYDTAVNIMQQIL
SAISLAHTHQIIHRDLKPQNVLIDNEGVVKITDFGIAIALSETSITQTNTMLGSVHYLSP
EQARGSMATKQSDIYALGIILYELLTGSVPFDGESAVTIALKHFQDELPSIKDLDPTTPQ
ALENVVLKATAKEPADRYKTAEEMSEDLATALSPARANEAKWVPQAMTKETQVITPLEED
TPMPESFKSMPLPKEKSEETPVMAEETVPDPKSKKHKKWWIILLVILALLGIGTAVFFAS
GGRGEVEIPDVSGLSEASARDTLAKAKLEAATKTEEIPDEQIEEGDVVKTDPAAGTTVKQ
NREVTLYVSTGKKKIKLDDYTGMNFDEVSSRLKKLGFPADSIEKKDEFSDEVENGRIISQ
SDEEGTEVDPTTDKITFVVSQGAQPTMGDYTGQNYDTVRGILSSNGYKRISETYDYSDTV
PAGSIISQLPSYGEPLTENSYISFVVSQGPNAKTLNDISGYTKSDAQSYLSSIGAEYIGH
ESYEYSDTVEKDKVIRTAPGVGASITPGTIVNVIYSKGPEPTKESKESSSSTKESSSSKE
SSSTTTSKEESTSSSSK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgattgagttaggcaaaaagttgaatggtcgttatcaaatcactggaaatattggtagt
gggggcatggcaaatgtttttctagcccatgaccttattttagatcgtgatgtcgcagtc
aaagtgttacgattcgatttccaaaatgatcaaacggcaattagacgattccaacgagaa
gcactagctgcgactgaactagttcatcctaatattgttagtgtgtatgatgttggagaa
gaagacaacatgcagtatctcgtgatggaatatgtaaaaggaatggacctgaaacgctat
attcaaacccattatcctgttccttatgatacagcagtcaatattatgcaacaaatttta
tcagctatttctttagcacatacgcaccaaatcattcatcgtgatttgaaaccacaaaat
gtcttgatcgataatgagggcgtggtcaaaatcactgattttggtatagcaatcgcatta
tctgaaacatcgatcacacaaacgaatacgatgttaggctctgtccattacttatctcct
gaacaagctagaggaagtatggctacgaaacaatcagatatctatgccttagggatcatt
ctttacgaattattaactggcagtgttccttttgatggtgagtctgcagtgacgattgcc
ttgaagcatttccaagatgagttaccttcaatcaaggatctagacccaacaacgccgcaa
gctttagaaaatgtggtattgaaagctactgcaaaagaaccggcagatcgatataaaaca
gcagaagaaatgtcagaagacttagcaacagcgctgtctcctgctcgggcaaatgaagcc
aaatgggtgccacaagcaatgaccaaagaaactcaagtgatcacaccattagaagaagat
acaccaatgccagagtcatttaaatccatgccattacctaaagaaaaatcagaagaaact
cctgtgatggcagaagagacagttcctgatccaaagagtaaaaagcataaaaaatggtgg
attattttattggtgatcttagccttattaggaatcggaacagccgtcttttttgcttct
ggaggtcgtggagaagtcgaaattcctgacgtttcgggattatcagaagcgtctgccaga
gatactttagcaaaagctaaattagaagcagcaacaaaaaccgaagagatccctgatgaa
caaatcgaagaaggagacgttgtcaaaacggacccagcagcgggaactacagtgaaacaa
aaccgtgaagttaccctttacgtcagcacaggtaagaaaaaaatcaagttagatgattat
actgggatgaattttgacgaagtaagtagccgattgaagaagcttggttttccagctgat
agtatcgagaaaaaagacgagttcagtgatgaagtagaaaatggacgaatcatttcccag
tcggatgaagaaggaacggaagtcgatccaacgacagataagatcacatttgttgtgagc
caaggcgcgcaaccaacgatgggggattatactggtcaaaattatgacaccgttcgtggg
atattgagctcaaatggttataaaaggatcagtgagacgtatgattacagcgatacggtt
ccagctggttcaatcattagccaattacctagttacggtgaaccattgactgaaaatagc
tatatcagttttgtcgttagtcaaggaccaaatgcgaaaacattaaatgatatttcaggc
tatacgaaaagtgatgcacaaagttatttatcaagtattggcgcagaatacatcggacat
gagtcttatgaatattctgataccgtagaaaaagataaagtgatccgaacagctcctggc
gtgggggcatcgattactccaggaacgatcgtcaatgtcatttattcaaaaggaccagaa
ccaaccaaagaatcaaaagaatcatcaagttcaaccaaagaatcgtcaagcagcaaagaa
agttcaagtactactacgtctaaagaagaaagcacgtcgtcttcatccaaatag

DBGET integrated database retrieval system