KEGG   Enterococcus hirae: EHR_11480Help
Entry
EHR_11480         CDS       T02160                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ehr  Enterococcus hirae
Brite
KEGG Orthology (KO) [BR:ehr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EHR_11480
Enzymes [BR:ehr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EHR_11480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored FAD_binding_2 Thioredoxin_3 HI0933_like AlaDh_PNT_C FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AFM71175
UniProt: I6S3A7
LinkDB All DBs
Position
complement(2241789..2243327)
Genome map
AA seq 512 aa AA seqDB search
MLDKETKQNLAQYLDLMEAPVVFSVSTDDTANSQQLFEFVNEVADMTDKITVEQKTLPRT
PSFEINSLQKTSGITFAGIPLGHEFASFLLALLQVSGRPPKIADTLIQSILEINQPLHFE
SYVSLTCHNCPDVVQALNILAVLNPLITHTMIEGGMYQHEITEKQIMAVPTVFLNEKEFA
SGRMTIEQILGKIAGPNLMEQKEINTKELFDVLVIGGGPAASSAAIYAVRKGLRTGLVTD
TLGGQVVETLGIENLIGTPYTEGPRLMKQVEEHLRSYPVDVMTNQQVVSLNKGADLFEIN
LKSGNQLKSKTTIVATGAHWRSINVPGEKEFKNKGIAYCPHCDGPLFAGKEIAVIGGGNS
GIEAAIDLAGLAKHVYILEFLPTLKADQVLQDKLATLTNVTVILNAQTKEISGQTKVDSL
SYIDRSTQEEHTIAVSGVFILIGLVPNTDWLVGTLELNDRGEIITDAHGATSEAGLYAAG
DCTDSAYKQIIIAMGSGATAALGAFDYLMRKE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaggaaacgaaacaaaatttagctcaatatcttgatttaatggaagcacca
gttgttttttcggttagtacagatgacacagccaattcccaacaactattcgagtttgtg
aacgaagtggcagatatgactgataaaattacggttgaacaaaagacgttgccacgtacc
cctagctttgaaatcaattctttacaaaagactagcgggatcactttcgcaggtattcct
ttaggccacgagtttgcatctttcctccttgctttattacaagtaagtggacgaccacct
aaaatagctgatactttgattcaatccattttagaaattaatcagcctctacattttgag
agctatgtcagtttaacctgtcacaactgccctgatgttgttcaagcgttaaacatttta
gcggttttgaatccgttgatcacccatacgatgatcgaaggtgggatgtatcagcatgaa
atcactgaaaaacaaatcatggccgtgccaaccgtctttttaaacgaaaaagaatttgct
agtggacgaatgacgattgaacaaattttaggaaaaatagctggcccgaatctaatggaa
caaaaggaaatcaatacaaaagaattatttgacgttctagttatcggtggcggtccagca
gcaagcagcgcagcgatttacgcagttagaaaaggcctccgtactggactcgtaactgat
acacttggcggtcaagtcgtagaaacgttaggcatcgaaaatctaatcggtacaccttac
acagaaggtccacgattgatgaaacaagtcgaagaacatttacggtcttatcctgttgat
gttatgacaaatcaacaagttgtgtcactaaacaaaggagcagatctctttgaaatcaat
ttaaaaagcggcaatcaactgaaatcaaaaacaacgattgttgcaacaggagctcattgg
cgttccatcaatgttcctggtgaaaaagaatttaaaaacaaaggaattgcctattgtcct
cattgcgatggtcccctctttgccggaaaagaaatcgcagtgattggtggcggaaattca
gggattgaagctgccattgatttagctgggttggcgaaacatgtatatattttagagttt
cttccgacacttaaagcagaccaagtattacaagataaactagctactttaacaaatgtc
actgtcattctaaatgcccagacgaaagaaatcagtggtcagacaaaggttgattcgttg
agttatatcgaccgttccacccaggaagaacacacaatagctgtttcaggtgtgtttatt
ctgatcggtttggttcctaatacggattggttagttggaacacttgagttaaatgatcga
ggagaaatcatcactgatgcccatggtgctaccagtgaagcaggactttacgctgctggt
gattgcacagatagtgcttataaacagatcattattgctatgggatcaggagctacagca
gcccttggtgcatttgactatttgatgagaaaagaataa

DBGET integrated database retrieval system