KEGG   Enterococcus hirae: EHR_13080Help
Entry
EHR_13080         CDS       T02160                                 

Definition
(GenBank) putative L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
ehr  Enterococcus hirae
Pathway
ehr00040  Pentose and glucuronate interconversions
ehr00053  Ascorbate and aldarate metabolism
ehr01100  Metabolic pathways
ehr01120  Microbial metabolism in diverse environments
Module
ehr_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:ehr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EHR_13080
   00053 Ascorbate and aldarate metabolism
    EHR_13080
Enzymes [BR:ehr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     EHR_13080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFM71476
UniProt: I6T9E5
LinkDB All DBs
Position
complement(2541234..2541653)
Genome map
AA seq 139 aa AA seqDB search
MAQIGIYEKALPKDISWKERFLLAKELGFSFIEMSIDETDERLARLNWSDEMINQIRKDM
KETGIRINSICLSGHRRFPFGSSNEAYRIKAKELMVKAIRLAQRLSIKIIQVAGYDVYYE
KKQGYHENYLLKDLKKASK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaaatcggaatttatgagaaggcactaccaaaagatatctcttggaaagagcgc
tttttattagcaaaggaacttggtttttcctttattgagatgtcgattgacgagacagat
gaacgcctagctcgactcaattggtctgacgagatgatcaatcaaatacgcaaagacatg
aaagagacgggcattcggatcaattccatttgtctgagtggtcatcgcaggtttcctttt
ggctcttcaaatgaagcgtatcggataaaagccaaagaattgatggtcaaagcgatccga
cttgctcagcgcttaagtatcaaaattatccaagtagccggatacgatgtctattatgaa
aaaaaacaaggctatcacgaaaattatttattgaaggacttgaagaaagcgtcaaaatag

DBGET integrated database retrieval system