KEGG   Emiliania huxleyi: EMIHUDRAFT_119393Help
Entry
EMIHUDRAFT_119393 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    EMIHUDRAFT_119393
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ehx01003]
    EMIHUDRAFT_119393
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ehx03036]
    EMIHUDRAFT_119393
Enzymes [BR:ehx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     EMIHUDRAFT_119393
Glycosyltransferases [BR:ehx01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   EMIHUDRAFT_119393
Chromosome and associated proteins [BR:ehx03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     EMIHUDRAFT_119393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_8 TPR_17 TPR_16 TPR_12 TPR_7 TPR_10 TPR_14 TPR_5 TPR_19
Motif
Other DBs
NCBI-GeneID: 17261390
NCBI-ProteinID: XP_005767675
JGI: Emihu1_119393
UniProt: R1DWV8
LinkDB All DBs
Position
Unknown
AA seq 732 aa AA seqDB search
MPCDRRSSVPGDLSRRGWELTEAGDADAALACHREATGLPGAGGRTWFHRARSEQRFGHD
AAARSSFGRSLAASLPPAEAKEAHFQLGKLQRDAGLLAEAEASYRAVLAIDPLLAGAHIL
LGVVLRELGRLEESVEAYGEGLRLNPSARLHHSLGKAHYLRGRRQEAAAAHAAALALDPS
FAYAHNDLGNAHHHCAEAACSQLQAHSNLGTALKGLGRHAEATAHTRATRRSPCGAVRGM
ACSLSRQAAASYSAAIRLKPHLCEAHKNLGAALTELGRPRDAALYDLLDGQQFLCDWRGR
EARLRELERHLDEWHSRGRLGAGPTERLHAGLAPFHTLVWPVSDKTRRRVALSRARRDVE
AAEAAPLVPPLRWGGGGGGGGHGGGGGGGILRLGFLSSDFGPHPVVCLALDLPERQHAGT
AERRAIAAAAHAFFDLTRLTDAEAARAIDGLRLHVLVNLVGHTAGARHALTHYRPAPMHY
ALLDAAAAPPPLAAAEFTERMAYFPFSHFVAAHARRYAHAPHASRLAHPWPAGEWPAGEE
ERATWSPALRRASLWLSRVSVRRGWAEHAEQSLRAQAAAHGVTGRLGFVPKLPEADFIPA
RSLADLMVDNRWYNAHTTGADSLWAGVPAVALQGRGLASRASGSFLAALGLGYTVAPSWK
AYEDLICSLASTPERLQLLRRRLLDARSDAPFFDLEGLARAQERLVHGMWRAHEASPASG
PKMHIIAARART
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtgaccgacgctcctccgtgcctggcgacttatcgcgacgcggctgggagctg
accgaggctggcgacgctgacgccgctctcgcctgccaccgcgaggcgaccgggctgccc
ggcgcgggcgggcgcacctggttccaccgtgcgcgcagcgagcagcgctttgggcacgac
gcggcggcgcgctcgtcgttcggccgctcgctcgccgccagcctccctcctgctgaggcc
aaggaggcgcactttcagctcggcaagctgcagcgcgacgccggcctgcttgccgaggcg
gaggccagctaccgcgccgtgctggcgatcgacccgctgctcgccggcgcgcacatcctg
ctcggcgtcgtgctgcgcgagctcggtcgcctcgaggagtcggtcgaggcgtacggagag
ggcttgcggctcaacccgtcggcgcggctgcaccactcgctcggcaaggcgcactacctc
cgaggccgacggcaggaggcggcggcggcgcacgctgcggcgctcgccctggacccgtcc
tttgcctatgcgcacaacgacctcggcaacgcgcaccaccactgtgccgaggccgcttgt
tcacagctgcaggcccactccaacctcggcaccgccctcaagggactcgggcggcacgcc
gaggccaccgcacacacacgcgccacccgccgctccccctgcggagcagtcagggggatg
gcatgctctctgtctcggcaggccgccgcgtcgtactcggccgccatccgcctcaagccg
cacctctgcgaggcgcacaagaacctcggcgcagccctcaccgagctcggaaggccgcgc
gacgccgcgctgtacgacttgctcgacgggcagcagttcctctgcgattggcgcggccgc
gaggcgcggctgagagagctggagcggcacctcgacgagtggcactcgcgcggcaggctc
ggggccgggccgaccgagcggctgcacgccggcctcgctcccttccacacgctcgtctgg
cccgtctcggacaagacgcgtcgccgagtcgcgctcagccgagcccgccgcgacgtcgag
gcggcggaggcggccccgctcgtgccgccgctgcggtggggcggcggcggaggcggcggc
ggccatggcggcggcggcggcggcggcattttgcggctcgggtttctgtcgtccgacttt
ggccctcaccctgtggtctgcctcgcgctcgacttgcccgagaggcagcacgctgggacc
gccgagcggcgcgcgatcgccgcggcggcgcacgctttcttcgacctcacccgcctcacc
gacgcggaggcggcgcgcgcgatcgacggcttgcggctgcacgtcctcgtcaacctcgtc
ggccacaccgcgggggcgcggcacgccctcacgcactaccgccccgcgccgatgcactac
gcgctgctcgacgccgcggcggcgccgccgccgctcgcggcggccgagtttaccgagcgg
atggcctacttccccttctcccactttgtggcggcgcacgcgcgccgctatgcgcacgcg
ccccacgcctcccgcctcgcccacccgtggccggccggcgagtggccggccggcgaggag
gagcgcgccacgtggtcgcccgcgctgcggcgtgcgtcgctgtggctctcgcgcgtctcg
gtgcggcgcggctgggcggagcatgcggagcagagcctgcgcgcgcaggcggcggcacac
ggcgtgaccggccggcttggcttcgtcccaaagctgcccgaggccgactttatccccgcg
cgctcgctggccgatctgatggtggacaaccgctggtacaacgcgcacaccaccggcgcc
gactcgctgtgggcgggcgtgcccgccgtggcgctgcaggggcgcggcctcgccagccga
gcgtcgggctccttcctcgccgcgctcggcctcggctacaccgtggctccgagctggaag
gcgtacgaggacctgatctgcagcctcgcttcgacccctgagcggctgcagctgctccgg
cggcggctgctcgacgcgcggagcgacgcgcccttctttgacctcgagggactcgcgcgc
gcgcaggagcggctcgtgcacggcatgtggagggcacacgaggcgtcgccggcctccggc
ccgaagatgcacatcatcgccgcgcgggcaaggacgtga

DBGET integrated database retrieval system