KEGG   Emiliania huxleyi: EMIHUDRAFT_204636Help
Entry
EMIHUDRAFT_204636 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ehx03021]
    EMIHUDRAFT_204636
   03036 Chromosome and associated proteins [BR:ehx03036]
    EMIHUDRAFT_204636
Transcription machinery [BR:ehx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     EMIHUDRAFT_204636
Chromosome and associated proteins [BR:ehx03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    EMIHUDRAFT_204636
   PBAF complex
    EMIHUDRAFT_204636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 17273250
NCBI-ProteinID: XP_005780133
JGI: Emihu1_204636
UniProt: R1F3E6
LinkDB All DBs
Position
Unknown
AA seq 209 aa AA seqDB search
MAPAAAPPGPPAVILPSYAAWFDPNAVHAIERRALPEFFDGSSAVKTELAYTEARNFIVS
SYREQPALYLPLTEVRRHLAIDVAAATRLHRFLEHWGIINYSRHTLSARPETFPSGGGSG
WSDDDTLALLEALGRVGEGRWEEVAAHVGKSVDECVQRFVELPIEEPHGFEALRAPPNMV
AITLAPSPAVKAEEAPDVKMHEAHNGSGQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggctgccgctccgccaggaccgccagcagtcattttgccttcgtatgccgcc
tggttcgatccgaatgcggtgcacgcgatcgagcggcgcgcgctgcccgagttcttcgac
ggctcttcggccgtcaagacggagctcgcgtacaccgaggcgcgcaacttcatcgtcagc
tcgtaccgcgagcagccggcgctgtacctcccgctcaccgaggtgcggcgtcatctcgcc
atcgatgtcgccgccgccacgcggctgcaccgcttcctcgagcactggggcatcatcaat
tacagccggcacacgctgagcgcgcggccggagaccttcccgtccggcggcgggagtggc
tggtcggacgacgacacgctagccctgctcgaggcgctcggccgggtgggggaggggcgg
tgggaggaggttgccgctcacgttggcaagtcggtcgacgagtgcgtccagcgcttcgtc
gagctccctatcgaggagccgcacggcttcgaggcgctgcgcgccccgcccaacatggtg
gcgatcactttggcgccgtctcccgcggtcaaggcggaggaggcccccgatgtgaagatg
cacgaggcgcacaacgggagcggacagtga

DBGET integrated database retrieval system