KEGG   Emiliania huxleyi: EMIHUDRAFT_231986Help
Entry
EMIHUDRAFT_231986 CDS       T02915                                 

Definition
(RefSeq) arginine biosynthesis bifunctional protein A
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00220  Arginine biosynthesis
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
ehx01130  Biosynthesis of antibiotics
ehx01210  2-Oxocarboxylic acid metabolism
ehx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EMIHUDRAFT_231986
Enzymes [BR:ehx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     EMIHUDRAFT_231986
    2.3.1.35  glutamate N-acetyltransferase
     EMIHUDRAFT_231986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-GeneID: 17276661
NCBI-ProteinID: XP_005783817
JGI: Emihu1_231986
UniProt: R1D7L7
LinkDB All DBs
Position
Unknown
AA seq 418 aa AA seqDB search
MVLWLASALTSLVGTRRIATGRATTAQMRSFSSTSEYEQALAAEATLPSGFQVGTAGFRF
SPAEAAEGTRATMNLTLIVADAPSSSWAAVFTKNAFCGAPVTVGRNRLAAGGDLQAIVVN
NKISNVCSGSDGVGDSEAVCAAAADALSLPGGASSAVPAAAAELQRESMLPAARAIMTTD
RYPKLRRASAAGGSIATMLSFVLTDVAVPRAELQRMLAAAADASFNCMSIDADQSTSDSL
VLFSSGRALAEFEAALKRVCDQLAADVARNGEGTTRVAVWAWGEGLGASSDPSRSPPVRH
VLRVAVRGAPSAELARGVGKAVVNSPLVKTAVAGNDPNVGRIVGAVGSFLGRAAPQLDLG
QCTMAIGGDTAQQESAPFPPHERFVEVEIDLGAGGEASTVIGSDLTREYVDINADYRS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctggctcgcctccgctctcaccagcctggttggcacccgccgcattgccacc
gggcgtgccaccacggcacagatgcgctccttctcgtcgaccagcgaatatgagcaggca
ctcgcggcggaggctacgctcccgtctggcttccaagtgggcacggccggcttccgcttc
tctcccgccgaggcggccgagggaacgcgagccacgatgaacctgacactcatcgtcgcc
gacgctccctccagcagctgggccgccgtcttcaccaagaatgccttttgcggcgctccg
gtgactgtcggccggaatcggctcgcggcgggcggtgacctgcaggccatcgtcgttaac
aacaagatctcgaacgtgtgctccggcagcgacggcgtgggcgactcggaggcggtctgc
gccgccgccgccgacgcgctctcgctgcccggcggcgcctcgtctgcggttcccgcagcg
gcggcggagctgcagcgggagagcatgctgcccgcggcgcgcgccatcatgacgacggac
cggtaccccaagctccgccgcgcctccgccgccgggggctccatcgccaccatgctctcc
ttcgtgctgaccgacgtcgccgtgcctcgcgccgagctgcagcgcatgctcgcggcggcg
gcggacgcctccttcaactgcatgtccatcgacgccgaccagtcgacctccgactcgctc
gtcctcttctcgagcggacgggcgctcgcggagttcgaggcggcgctgaagcgcgtgtgc
gaccagctggcggcagacgtggcgcgcaacggcgaggggacgacgcgcgtggctgtgtgg
gcctggggggaggggttgggggcctcttcggatccttctcggagccctcctgtcaggcac
gtgctccgggtggcggtgcgaggcgctccgtcggcggagctggcgcgcggcgtcggcaag
gccgtcgtcaactcgccgctcgtcaagacggccgtcgcgggcaacgaccccaacgtgggc
cgcatcgtcggcgccgtcggttccttccttggcagggctgcgccgcagctcgacctcggg
cagtgcacgatggccatcggcggcgacaccgcgcagcaggagagcgcgcccttcccgccg
cacgagcgcttcgtcgaggtggagatcgacctcggcgccggcggggaggcgagcacggtc
atcgggtccgacctcacgcgcgagtacgtggacatcaacgccgactaccgctcgtga

DBGET integrated database retrieval system