KEGG   Emiliania huxleyi: EMIHUDRAFT_250053Help
Entry
EMIHUDRAFT_250053 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00310  Lysine degradation
ehx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    EMIHUDRAFT_250053
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ehx03036]
    EMIHUDRAFT_250053
Enzymes [BR:ehx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     EMIHUDRAFT_250053
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     EMIHUDRAFT_250053
Chromosome and associated proteins [BR:ehx03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     EMIHUDRAFT_250053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TrbM
Motif
Other DBs
NCBI-GeneID: 17252192
NCBI-ProteinID: XP_005758474
JGI: Emihu1_250053
UniProt: R1CUR2
LinkDB All DBs
Position
Unknown
AA seq 270 aa AA seqDB search
MHDFEDVSYSYPHGESLSEACSACLCWSAAAQPLRCEGWLSRIHSMKSRKFSPRERSTAC
FLLRAFAQRASEANHRHSQPALDGEPSFEQATAQCQQVARSGASASSAARIVRLAKLQAG
RLVDEADALRLVGAEACNSFHLFDERERVRGSAMYPEAAMINHSCLPNCVMTAHGRHLAL
ESISPISRGEELTYCYVRSFEAGSKETLDPWGFECDCVRCAGTHPEGGEGLEAFDAKHKC
TCGKIVKATMARVAAESGRCRCHAHNTTSG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcacgactttgaagacgtgagctactcgtacccacacggagagtcgctgagcgaggcc
tgcagcgcctgcctctgctggagtgctgcagcgcaaccgctgcgctgcgagggctggctc
agcaggattcacagcatgaagagcagaaagttctctccccgcgagagatcgacggcgtgc
tttctgctgcgcgccttcgcgcagcgcgcgtccgaggcgaatcaccggcactcgcagccg
gcgctcgacggcgagccttcttttgagcaagcgaccgcgcagtgccaacaggttgcacgc
tccggcgcgtcggcctcctctgctgcgcgcatcgtgcgcctcgccaagctgcaagcggga
cgactggttgacgaggcggatgccttgcgtctggtcggggcggaggcatgcaactcgttc
cacctatttgacgagcgggagcgcgttcgaggcagcgccatgtacccggaggccgcgatg
atcaaccacagttgcctgccgaactgcgtcatgactgcccacggtcggcatctcgccctc
gagtccatctcccccatatcgcgcggcgaggagctcacgtactgctatgtgcgctccttt
gaggcggggagcaaggaaaccctcgacccgtggggctttgagtgtgactgcgtgaggtgc
gctggcacacatcccgaaggaggcgaggggctggaggcctttgatgccaagcacaagtgc
acttgcggcaagattgtgaaagctacaatggcccgtgtcgccgcagagagcggacgctgt
cgctgccatgcgcacaacacaacaagcgggtga

DBGET integrated database retrieval system