KEGG   Emiliania huxleyi: EMIHUDRAFT_369379Help
Entry
EMIHUDRAFT_369379 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00061  Fatty acid biosynthesis
ehx00780  Biotin metabolism
ehx01100  Metabolic pathways
ehx01212  Fatty acid metabolism
Module
ehx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EMIHUDRAFT_369379
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EMIHUDRAFT_369379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ehx01004]
    EMIHUDRAFT_369379
Enzymes [BR:ehx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     EMIHUDRAFT_369379
Lipid biosynthesis proteins [BR:ehx01004]
 Fatty acid synthase
  Component type
   EMIHUDRAFT_369379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-GeneID: 17265304
NCBI-ProteinID: XP_005772187
JGI: Emihu1_369379
UniProt: R1CAN9
LinkDB All DBs
Position
Unknown
AA seq 90 aa AA seqDB search
WAGAETWSKAFAEPEAIFEINRIKEILPHRYPFLLVDKVIEFEAGKRCVGVKKVTSNEEF
FNGHFPQRPIMPGVLQVEAMAQVGGLVALQ
NT seq 272 nt NT seq  +upstreamnt  +downstreamnt
tgggccggcgccgagacgtggtccaaggcatttgccgagccggaggccatcttcgagatc
aaccgcatcaaggagatcctgccgcaccgttaccccttcctgctggtggacaaggtgatc
gagtttgaggccggcaagcgctgcgtcggcgtcaagaaggtcacgtccaacgaggagttc
ttcaacggccacttcccgcagcggccaatcatgccgggcgtgttgcaggtcgaggcaatg
gcgcaggtgggcggcctggtggcgctgcagga

DBGET integrated database retrieval system