KEGG   Emiliania huxleyi: EMIHUDRAFT_428156Help
Entry
EMIHUDRAFT_428156 CDS       T02915                                 

Gene name
HXK2
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00010  Glycolysis / Gluconeogenesis
ehx00051  Fructose and mannose metabolism
ehx00052  Galactose metabolism
ehx00500  Starch and sucrose metabolism
ehx00520  Amino sugar and nucleotide sugar metabolism
ehx00524  Neomycin, kanamycin and gentamicin biosynthesis
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
ehx01130  Biosynthesis of antibiotics
ehx01200  Carbon metabolism
Module
ehx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EMIHUDRAFT_428156 (HXK2)
   00051 Fructose and mannose metabolism
    EMIHUDRAFT_428156 (HXK2)
   00052 Galactose metabolism
    EMIHUDRAFT_428156 (HXK2)
   00500 Starch and sucrose metabolism
    EMIHUDRAFT_428156 (HXK2)
   00520 Amino sugar and nucleotide sugar metabolism
    EMIHUDRAFT_428156 (HXK2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EMIHUDRAFT_428156 (HXK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ehx04131]
    EMIHUDRAFT_428156 (HXK2)
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     EMIHUDRAFT_428156 (HXK2)
Membrane trafficking [BR:ehx04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    EMIHUDRAFT_428156 (HXK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Terminase_GpA
Motif
Other DBs
NCBI-GeneID: 17255984
NCBI-ProteinID: XP_005762293
JGI: Emihu1_428156
UniProt: R1DME7
LinkDB All DBs
Position
Unknown
AA seq 453 aa AA seqDB search
MAARDAAWEALRDEFALPPASMENLRQLFLTEARAGLAGSDSSLRMLPTYLTRRVTGEET
GEYFALDLGGTHFRVLQLRLEGGGRIGPVRQRQFKVPDAAKRGSGAELFGFLADCVSAFV
AAECGGEAAGDIGFTFSFPAAQTAIDAGTLVAWNKGFAAADAIGADVVALLQAQLEARGL
KMRVTALANDTVGTMAAAAYSCPGTAMGVIFGTGTNAAYVEQAAKIGKGRGVEDGSRETE
MAINTEWGNLDTAAVRNEHDAAVDAASENPGLQRFEKMVSGMYLGELLRTALAAPAVRAG
FSRTCAAGFDAAFSERFSLHTSTLAAIEADATPDLAEVAHLLAEAGVQGTLADRSLLRDA
CAAVSTRAALLAAVGIASLLELAQSEPRPATVAVDGTVFERYPGFQARMEGGLEMLLGPE
RARDVSLVLTKDGSGVGAAIIAAAAAQARGETQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcgcgacgccgcttgggaggcgctgcgcgacgagttcgccctcccgccggcg
tcgatggagaatctccgccagctcttcctcaccgaggcgcgggcggggctcgccggatcg
gacagctcgctgcggatgctgcccacctacctcacccgccgagtcaccggcgaggagacg
ggagaatacttcgcgctcgacctgggcggcacgcacttccgggtgctacagctgaggctt
gagggcggcggccggatcgggccggtccggcagcgccagttcaaggtgcccgacgcggca
aagcgtggcagcggcgcagagctctttggctttctcgccgactgcgtctccgcctttgtc
gcggccgagtgcggcggcgaggcagccggcgacatcggcttcaccttctcctttcccgcc
gcgcagaccgccatcgacgccggcacgctcgtcgcatggaacaagggctttgcggccgcc
gacgcgatcggagcagacgtcgtcgcgctgctgcaagcgcagctggaggcgcgcgggctg
aaaatgcgggtaaccgcgctcgccaatgacaccgtcggcacgatggcggccgcggcgtac
agctgtcccggcacggcgatgggtgtgatcttcggcacgggcacgaacgcggcgtacgtc
gagcaggcggcgaagattggcaaggggcgcggggtcgaggacggctctcgcgagaccgag
atggcgatcaacacggagtggggcaacctcgacacggcggccgtgcggaacgagcacgac
gccgccgtcgacgcggcctcggagaacccgggcctgcagcggttcgagaagatggtctcc
ggcatgtacttgggcgagctgctccggacagccctcgcggcgccggccgtgcgcgcaggc
ttctcgcgcacttgcgccgccggattcgacgccgcctttagcgagcgcttctcgctgcac
acctccacgctggcagccatcgaggcggacgcgacgcccgacttggccgaggtggctcac
ctgctcgctgaggcgggcgtccagggaaccctcgcggaccgctccctgctgcgcgacgcg
tgcgccgcggtctcgacgcgtgcggcgctcctcgccgccgtcggcatcgcatcgctgctc
gagcttgcgcagagcgagccgaggcccgccacagtcgccgtcgacggcaccgtcttcgag
cgctaccccggcttccaggcgaggatggagggcggcctcgagatgctgctcgggccggag
cgcgcgcgagacgtgtccctcgtcctgaccaaggacggctcgggcgtgggcgccgccatc
attgccgccgccgccgcgcaggcacggggcgagacacagtga

DBGET integrated database retrieval system