KEGG   Emiliania huxleyi: EMIHUDRAFT_437207Help
Entry
EMIHUDRAFT_437207 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00562  Inositol phosphate metabolism
ehx01100  Metabolic pathways
ehx04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    EMIHUDRAFT_437207
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    EMIHUDRAFT_437207
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ehx01009]
    EMIHUDRAFT_437207
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     EMIHUDRAFT_437207
    3.1.3.48  protein-tyrosine-phosphatase
     EMIHUDRAFT_437207
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     EMIHUDRAFT_437207
Protein phosphatases and associated proteins [BR:ehx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    EMIHUDRAFT_437207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 PH DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 17259329
NCBI-ProteinID: XP_005765622
JGI: Emihu1_437207
UniProt: R1BSU0
LinkDB All DBs
Position
Unknown
AA seq 813 aa AA seqDB search
MSGTVEKEGKLRWSSRWLVLQAGRLVVLRLPTSAVPLHVLPLDDNVRVTVGRGAREGSSF
TVVTRQRGHTFRTVDADGAEAWASALREECVHRSVRRSGAASEASVYGLAPTVEPRAEGG
SLCDAFAAMRQIESPLGDWPGERETTASDETLNDFEMAVGRTDAGEDGAAAQRCATAGAL
TVSTGGSAGERAEEAVLAGACGEAGGGGGGGTGAEGSGVSGGGDGGAEEVNAPGGGGASE
ELQEILQEELQEILQGFEDGDEVLPLLPGLAQEGVEEGVEEGDEGGGQGGDEAAGTTSSA
GRSAAAAVPAVPAAPNALGLLLAARAAFQHSVLRAAAPPPPKSPAAPLSVKQHQLASAVS
ETVAELSGFPRRASALPPHVLTRVSELGALSAVLPLPKSLGSLVEEATEWELSKGRGAVG
NAKHARASTGVTGALRTLVSKEKRRFAQDGFNLDLSYITPRVIAMGFPSEGTEAAYRNPM
SQVVSFLERRHREHYLVYNLCSERSYDPKHFGNRVKIFPFDDHNPPPLRMMPQLCASVAA
WHDEHPDNVAVVHCKAGKGRTGTMISAALLHRGDFRSADDALAFYGFARTNNCEGVTIAS
QRLYVHYYARLCREPAACERLLDRQAACRLVRVRLVTLPIGVSEKRPALCIKVTQHVPKT
AAWRSEAGAVGWVPASELALADGDSEGPPPPPKWRSSDAPMAPLVFSSAGKLIGTRPDVP
VVDVNTKSCPLLLSSDVRVEVSHRASGQMHDDKLFSFWFNAAMLSKPRLVLSKWQLDGGA
GKDAHHKRYNPHFRVELDFAPARLLDRMFAQPT
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtacggtggagaaggagggcaagctgcgctggtcgtcgcgctggctggtgctg
caggccgggcgcctggtggtgctgcggctgccgacgtcggccgtaccgctgcacgtcctc
cccctcgacgacaacgtccgcgtcaccgtcggcaggggcgcgcgcgagggctcctccttt
accgtcgtgacgcgccagcgcggacacacgttccgcacggtggacgcggacggcgcggag
gcgtgggcgtcggcgctgcgcgaggagtgcgtgcaccggtcggtgcgccgctcgggcgcg
gccagcgaggcgtccgtgtatggcctcgcccccactgtcgagccgcgcgcggagggagga
agcttgtgcgacgcgtttgcggcgatgcggcagatcgagtccccactgggtgactggccg
ggcgagcgggagacgactgcgtcggatgagacactcaacgactttgagatggcggtcggc
cggaccgacgcaggcgaggacggcgccgccgcccagcggtgcgcaaccgcgggcgcgctg
acggtgagcacgggtgggtctgcgggcgagagagcggaggaggcggtgcttgctggcgcg
tgcggcgaggcgggcggaggcggcggaggcgggacgggcgcggagggcagcggggtgagc
ggcggcggcgatggcggagccgaggaggtgaacgcgccaggcggcggcggcgcctcggag
gagctgcaggagatcctgcaggaggagctgcaggagatccttcaggggttcgaggacggc
gacgaggtgctgccgctcctgccggggctcgcgcaggagggcgtggaggagggcgtggag
gagggcgacgagggcggcgggcagggcggcgacgaggccgcgggcacgacttcctccgcc
ggccgctccgccgccgccgctgtccccgctgtccccgccgcaccaaacgcgctcgggttg
cttctcgccgcgcgcgccgcctttcagcacagcgtcttgcgggccgccgccccgcctccg
cccaagtcgccggccgccccgctcagcgtgaagcagcaccagctcgcgagcgccgtcagc
gagactgtcgccgagctctccggtttcccgcgccgcgcctcggcgctgccgccccacgtg
ctgacccgtgtctcggagctgggcgcgctctcggcggtgctgccgctcccaaagagcctg
ggctcgctcgtggaggaggcgacggagtgggagctctccaaggggcgcggcgccgtcggc
aacgccaagcacgcacgcgcgtcgacgggcgtcacgggcgcgctgcgcacgctcgtgtcc
aaggagaagcgccgtttcgcgcaggacgggttcaacctcgacctgtcgtacatcacgccg
cgcgtcatcgcgatggggttcccctccgagggcacggaggccgcctaccgcaacccgatg
tcccaggtggtctcgttcctcgagcggcgccaccgcgagcactacttggtctacaacctc
tgctcggagcgctcctacgacccgaagcactttggcaaccgcgtcaagatcttcccgttt
gacgaccacaacccgccgccgctgcgcatgatgccgcagctctgcgcgagcgtcgccgcg
tggcacgacgagcaccccgacaacgtcgccgtggtccactgcaaggcgggcaaggggcgg
accggcaccatgatctccgcggcgctgctgcaccgcggcgactttcggtcggcggacgac
gcgctcgccttctacggcttcgcgaggacaaacaactgcgagggcgtcaccatcgcgtca
cagcggctgtacgtgcactactacgcgcgcctctgccgcgagcccgccgcgtgcgagcgg
ctcctggaccggcaggccgcctgccggctggtgcgggtgcgcctcgtcacgctgccgatc
ggcgtctcggagaagcggccagccctctgcatcaaggttacccagcacgtcccaaagacg
gcggcgtggaggagcgaggcgggggcggtggggtgggtgcccgcgagcgagctcgccctc
gccgacggcgacagcgaggggccgccgccgccgccaaagtggcgcagctccgacgcgccg
atggcacccctcgtcttcagctcggcgggcaagctgattggcacgcggcctgacgtcccg
gtggtcgacgtaaacacaaagtcgtgcccgctgctgctgtcttccgacgtgcgggtggag
gtgtcccaccgcgcgagcggccagatgcacgacgacaagctcttctccttctggttcaac
gccgccatgctgagcaagccgcggctcgtgctgtccaagtggcagctggacggcggcgcg
ggcaaggacgcgcaccacaagcggtacaacccgcactttcgcgtcgagctcgactttgcg
cccgcgcgcttgctggatcggatgttcgctcaaccaacgtga

DBGET integrated database retrieval system