KEGG   Emiliania huxleyi: EMIHUDRAFT_450514Help
Entry
EMIHUDRAFT_450514 CDS       T02915                                 

Definition
(RefSeq) succinate dehydrogenase flavo protein subunit,subunit A Fp subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00020  Citrate cycle (TCA cycle)
ehx00190  Oxidative phosphorylation
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
ehx01130  Biosynthesis of antibiotics
ehx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EMIHUDRAFT_450514
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EMIHUDRAFT_450514
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EMIHUDRAFT_450514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 HI0933_like DAO NAD_binding_8 DivIVA
Motif
Other DBs
NCBI-GeneID: 17270100
NCBI-ProteinID: XP_005776983
JGI: Emihu1_450514
UniProt: R1EUN2
LinkDB All DBs
Position
Unknown
AA seq 615 aa AA seqDB search
MRRASSVLRAPLTRGRRGLASSSDYKITDHAYDAVVVGAGGAGLRAAFGLANHGFKTACI
TKLFPTRSHTVAAQGGINAALGNMSVDDWRWHMYDTVKGSDWLGDQDAIHYMCKEAPRTV
IELEHYGVPFSRTDEGKIYQRAFGGQSLDYGKGGQAYRCCACSDRTGHAILHTLYGQAVR
HETEFFLEYFALDLIMDDAGGCAGETAARTGARGGRSRPAVPLGACVGVMALCMEDGSLH
RFQCKNTVLATGGYGRAWYSATSAHTCTGDGSAMVARAGLPLQDLEFVQFHPTGIYGAGC
LITEGARGEGGILRNAEGERFMERYAPTAKDLASRDVVSRSMTMEINEGRGVGPDKDHIY
LYLNHIPPDVLAERLPGISETAAIFAECLRPTASDPDAIVPGLLAAGEAACASVHGANRL
GANSLLDIVVFGRACANRVAEIAKPGDPLTPLPKDAGAATIANLDKVRNSSGPKPTSAVR
ANLQKVMQTYAAVFRIQDKLETGCAEIDKVCKEMEEIGISDRSMIWNTDLVETLELQNLV
VQAAQTMYSAEARKESRGAHARDDFDTRDDENWMKHTLSWMATPADKVKLDYRPVHYYTL
DEEECKTVPPVARVY
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtgcttcgtccgtgctgcgcgcgccgctcacgcgggggcgccgcggcttggcc
tcgtcatcggactacaagatcacggatcacgcgtatgacgccgtcgtcgtcggagctggg
ggcgccggcttgcgcgcggcctttgggctcgccaaccacgggttcaagacggcgtgcatc
accaagctcttcccgacgcgctcgcacacggtggcggcgcagggtggcatcaacgccgcc
ctgggcaacatgtctgttgacgactggcgctggcacatgtacgacacagtcaaggggtcc
gactggctgggagaccaagacgcgatccactacatgtgcaaggaggcgccgcggacggtg
atcgagctcgagcactacggcgtccccttctcgcggacggacgagggcaagatctaccag
cgtgcctttggcggccagtcgctcgactacgggaagggcggccaggcgtaccgctgctgc
gcctgctccgaccggacggggcacgcgatcctgcacacactctacggccaggcggtgagg
cacgagacggagttcttcctagagtacttcgcgctcgacctcatcatggacgacgccggc
ggctgcgctggagagacggcggcccgcaccggggcgaggggtggtaggtctcgccccgcc
gtccctctaggcgcgtgcgtcggggtgatggcgctctgcatggaggatggctcgctgcac
cgcttccagtgcaagaacaccgtgctcgcgacgggcgggtacgggcgcgcgtggtactcg
gccacgtcggcgcacacgtgcacgggcgacgggtcggcgatggtggcgcgcgcggggctg
cccctgcaggacctcgagttcgtgcagttccacccgaccggcatctacggcgccgggtgt
ctcatcacggagggggcgcgcggggaaggagggatcctgcgcaacgcggagggcgagcgc
ttcatggagcggtacgcgccgactgcaaaggacctcgcctcgcgcgacgtcgtctcgcgg
tcgatgacgatggagatcaacgagggccgcggcgtggggccggacaaggaccacatctac
ctctacctgaaccacatcccgcccgatgtcctcgccgaacggctccccggcatctcggag
acggccgccatctttgccgagtgcctccggccgacggcgagcgatccggacgcgatcgtg
cccggcttgctcgcggcgggcgaggctgcctgcgcctcggtgcacggagccaaccggctt
ggcgccaactcgctcctcgacattgtcgtcttcgggcgcgcatgcgccaaccgcgtcgcc
gagattgccaagccaggcgacccgctcacgccgctgcccaaggacgcgggcgccgcgacg
atcgcaaacttggacaaggttcgcaactcgagcgggccgaagccgacctctgcggtgcgc
gccaacttgcagaaggtgatgcagacctacgccgccgtcttccgcatccaagacaagctc
gagacgggctgtgcggagatcgacaaggtgtgcaaggagatggaggagatcggcatttcg
gaccggtcgatgatctggaacacggacctcgtcgagacgctcgagctgcagaacctcgtc
gtccaggccgcgcagacgatgtactcggccgaggcgcgcaaggagtcgcgcggcgcacac
gcgcgcgacgacttcgacacgcgcgacgacgagaattggatgaagcacaccctctcgtgg
atggccacgccggcggacaaggtcaagctcgactaccggccagtccactactacaccctc
gacgaggaggagtgcaaaacggtgccgcccgtggcgcgggtgtactga

DBGET integrated database retrieval system