Emiliania huxleyi: EMIHUDRAFT_48776 Help Entry EMIHUDRAFT_48776  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K08336   ubiquitin-like protein ATG12 Organism ehx  Emiliania huxleyi Pathway ehx04136   Autophagy - other Brite KEGG Orthology (KO) [BR:ehx00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     EMIHUDRAFT_48776  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehx04131]     EMIHUDRAFT_48776    04121 Ubiquitin system [BR:ehx04121]     EMIHUDRAFT_48776    03029 Mitochondrial biogenesis [BR:ehx03029]     EMIHUDRAFT_48776 Membrane trafficking [BR:ehx04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     EMIHUDRAFT_48776 Ubiquitin system [BR:ehx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    EMIHUDRAFT_48776 Mitochondrial biogenesis [BR:ehx03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     EMIHUDRAFT_48776 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 Thump_like Motif Other DBs NCBI-GeneID:  17269647 NCBI-ProteinID:  XP_005776530 JGI:  Emihu1_48776 UniProt:  R1CVW6 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search KVTVTFKHAGDAPILKRSTFKLSASTTIAMTADQLRKQLGIAPHEPLLLYCSTAFAPPLD ETLGDVAQCF NT seq 210 nt NT seq  +upstreamnt  +downstreamnt aaggtgacggttacattcaagcacgccggtgatgcgccgatcttgaagcgctccactttc aagctctccgcctccaccacgattgcgatgactgcagaccagctgcgcaagcagctcggg atcgcaccgcacgaaccgctgctcctctactgcagcacggccttcgccccgccgttggat gagaccctgggcgatgtggcgcagtgcttt

DBGET integrated database retrieval system