Emiliania huxleyi: EMIHUDRAFT_49883 Help Entry EMIHUDRAFT_49883  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ehx  Emiliania huxleyi Pathway ehx03010   Ribosome ehx04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ehx00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     EMIHUDRAFT_49883   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EMIHUDRAFT_49883  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ehx03011]     EMIHUDRAFT_49883    04121 Ubiquitin system [BR:ehx04121]     EMIHUDRAFT_49883 Ribosome [BR:ehx03011]  Ribosomal proteins   Eukaryotes    Large subunit     EMIHUDRAFT_49883   Archaea     EMIHUDRAFT_49883 Ubiquitin system [BR:ehx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    EMIHUDRAFT_49883 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_5 DUF2604 Rad60-SLD_2 Dsc3_N Sde2_N_Ubi HATPase_c OTU1_UBXL Motif Other DBs NCBI-GeneID:  17276620 NCBI-ProteinID:  XP_005783773 JGI:  Emihu1_49883 UniProt:  R1FDK0 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MQIFVKTLTGKTITLEVEPSNNIENVKAKIQDKEGIPPEQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtcaagacgctgaccggcaagaccatcacgctcgaggtcgagccatcc aacaacatcgagaacgtcaaggccaagatccaggacaaggagggcatcccgcccgagcag cagcggctcatctttgcgggcaagcagctcgaggacggccgcaccctgtcggactacaac atccagaaggagtcgaccctccacctcgtcctccgcctccgcggggga

DBGET integrated database retrieval system