KEGG   Edwardsiella ictaluri: NT01EI_0167Help
Entry
NT01EI_0167       CDS       T00912                                 

Definition
(GenBank) translation elongation factor Tu, putative
  KO
K02358  elongation factor Tu
Organism
eic  Edwardsiella ictaluri
Brite
Translation factors [BR:eic03012]
 Eukaryotic Type
  Elongation factors
   NT01EI_0167
 Prokaryotic Type
   NT01EI_0167
Mitochondrial biogenesis [BR:eic03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NT01EI_0167
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NT01EI_0167
  Exosomal proteins of breast cancer cells
   NT01EI_0167
  Exosomal proteins of colorectal cancer cells
   NT01EI_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ACR67415
UniProt: C5BGM7
LinkDB All DBs
Position
163701..164885
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIIELAETLDSYIPEPERDIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
DEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIT
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgttcaaaaccgcacgttaacgtcggtactatcggccac
gttgaccacggtaaaactaccctgaccgctgctatcaccaccgttctggctaaaacctac
ggcggtagcgctcgtgcattcgatcagatcgataacgcgccggaagaaaaagcacgtggt
atcaccatcaacacctctcacgttgaatacgataccccgacccgtcactacgctcatgta
gactgcccggggcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcaatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgccaggtaggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gttgatgacgaagagttgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccgggcgacgacacgccggtaatccgcggttctgcgctgaaagcgctggaa
ggcgaagccgagtgggaagccaagatcatcgaactggctgaaaccctggattcctacatc
ccggaacctgagcgcgacatcgacaagccgttcctgctgccgatcgaagacgtattttct
atctctggccgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaggtaggt
gatgaagttgaaatcgttggtatcaaggcgactaccaaaaccacctgtaccggcgtagaa
atgttccgcaaactgctggacgaaggccgtgccggtgagaacgttggcgttctgctgcgt
ggtaccaagcgtgacgaaatcgagcgtggtcaggtactggcgaagccgggctccatcact
ccgcacaccaagttcgaatcagaagtgtacatcctgagcaaggatgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtaacgggc
accatcgaactgccggaaggtgtagagatggtaatgccgggcgacaacatcaagatggtt
gttaccctgatccacccgatcgccatggacgatggtctgcgcttcgcaatccgcgaaggc
ggccgtaccgttggtgcgggcgttgttgctaaagttatcgaataa

DBGET integrated database retrieval system