KEGG   Edwardsiella ictaluri: NT01EI_0252Help
Entry
NT01EI_0252       CDS       T00912                                 

Definition
(GenBank) copper/zinc superoxide dismutase, putative
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
eic  Edwardsiella ictaluri
Brite
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NT01EI_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACR67495
UniProt: C5BCD2
LinkDB All DBs
Position
257957..258484
Genome map
AA seq 175 aa AA seqDB search
MKKMKVLVLATMLLSGAAYSASESVTLYEALPSGVGPAIGEVTISETPYGLLFTPSLRTL
PPGIHGFHVHENASCLPGAKEGKPVPALMAGGHWDPEKRDKHMGPYSDAGHLGDLPGLVV
NADGTADYAVLAPRLKSLAQLKGHALMVHAGGDNYDDHPHALGGGGARMACGVIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaaagtattggtattagccacgatgctgttaagcggcgccgcttacagc
gcctctgagtccgtaacgttgtatgaggcgctgccgtcgggggtggggccggcgatcggt
gaagtgacgatcagtgaaacgccctatggcctgctgtttacgcccagcctgcgcactctg
ccgcctggaatccatggttttcatgtccatgaaaacgccagctgcctgccgggtgccaaa
gagggtaaaccggtgccggcgttgatggccggtggtcactgggatcctgagaagcgcgat
aagcatatggggccctacagcgatgccgggcacctgggcgatctgccgggactggtggtc
aatgcggacggcacggcggactatgccgtactggcgccgcgtctgaagtctctcgcccag
ctgaaaggacatgcgctgatggtgcacgccggcggcgataactatgacgatcatccgcac
gcgctgggcggcggcggtgcccgtatggcctgcggcgttatccagtaa

DBGET integrated database retrieval system