KEGG   Edwardsiella ictaluri: NT01EI_0337
Entry
NT01EI_0337       CDS       T00912                                 

Definition
(GenBank) hypothetical protein
Organism
eic  Edwardsiella ictaluri
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: ACR67579
UniProt: C5BCX3
LinkDB
Position
340554..341309
AA seq 251 aa
MAELQRNGPPQPRPEKPHDLLYNVFWGWPWALIGMLLGSLMLSLLIEYTGIAFFWPEAGA
AHSEAVMNTELGWLSTEFTRSLLLSEPSVTVSRWVTTAYQWLFVDSGFTGWIKQHVLQTG
SGNELTRNLSSWSGWLAGYLHEYLTATVWICVITLVRVTILVLSVPLFLMVVLVALVEGL
GRRDLRRYGAGYESSFVYHHAKKRVKPAIVVPIILYLSWPTAVYPNLLLLPAAILLGVAI
TVTMASFKKYL
NT seq 756 nt   +upstreamnt  +downstreamnt
gtggctgaacttcagcgtaatggtccgcctcagccccggccggagaagccacatgatctg
ctttataatgtgttctggggctggccctgggcgctgatcggcatgctgctgggttcgctg
atgctgagcctgctgattgagtacaccggcattgcgttcttctggccggaagcgggtgca
gcccacagcgaggcggtgatgaataccgaactgggctggctgtcgacagaattcacccgc
agcctgttgctgtcggagccttctgtgactgtttcccggtgggtaacaactgcgtatcag
tggctgtttgttgacagtgggtttactggctggataaagcagcatgtgctgcagacgggc
agcggtaacgagctgacccgtaatctgagcagctggagtgggtggcttgcgggctatctg
catgaatatctgacggcgaccgtgtggatatgcgtgattaccctggtgcgggtgaccata
ctggttctgtcagtcccactgtttctgatggttgtactggttgcgttggttgaaggactg
gggcgcagggatctgcggcgctatggggcgggttatgaaagctcgtttgtttatcatcat
gctaaaaagagggtgaaaccagcgatagtggtgcccataatactgtatctttcctggccg
acggcggtgtaccctaacctgctgttgttacctgctgctatattactgggtgtcgccatc
acggtcaccatggcttcattcaagaaatatctttag

DBGET integrated database retrieval system