KEGG   Edwardsiella ictaluri: NT01EI_0347
Entry
NT01EI_0347       CDS       T00912                                 

Definition
(GenBank) hypothetical protein
Organism
eic  Edwardsiella ictaluri
SSDB
Motif
Pfam: TraC_F_IV AAA_10 AAA_22 P-loop_TraG AAA_29 T2SSE DUF87
Other DBs
NCBI-ProteinID: ACR67589
UniProt: C5BDH3
LinkDB
Position
346996..349860
AA seq 954 aa
MFSLFGRKNEVKPDGTAGQPEGEVSPLVIHGREPLTRPGRMTRQEEAKVYHANPSIIDYL
PWVEFLDEDQCLLLEDGISVGAVYDVKPVATEGRTNDRLEQIRDTVEDALQDSFDEYDEN
PWVVQFFCQDEDDAEAYLDHLRGYVKPHAQRTAFTEAWLGEMARHIRSISRPEGLFTDAL
ITGQLWRGQQRRTRMVIYRWSGKSASRDPMPPVAMLNQACERVVSALGGAGIRCTRQNGL
QVHSWLLRLFNPSPDWVDKSTLYRQAAYADPRDFPAGVAPVSNDFAETLWFTPPVSDPEN
GVWWIDNKLHCALPVERLRTPPEPGTITGEQARGEKKINALMDMFPEGTLLCMTIVVQPQ
DRLEEQFNRLSKNAVGENTESGRVRQDVKTVKEYLGNRHKLYRAGITFLLRGDDMDNLKR
KRLDLTTVLLGAGLQPVRSEFEVGPLNTWLRALPMCFNPNSDKKHWYTRLTWVQHLAGLL
PVTGRETGTGNPGFSFFNRGGDILTFDPLNKYDRTQNAHLLLFGPTGAGKSATLCYAFSQ
LMAVHRPRLFIAEAGNSFGLQADYFESLGLSVNKISVKPGSGVSLPPFADAHKLVEEGLA
AHAVDESDLPDIDADSDGEGEDEDKRDILGEMEISARMMITGGDPKEEAEMKRADRAMIR
EALLMAAHATYKEGRQMLPSDLQKALYSIAGDDSDEGQNVRNAQRKAKAAEMAEALGMFT
QEGSFEAELFNREGELWPEADVTLVDLGHLAREGYEAQMALTMVSMTNMINNIAERDQYL
GRDIVFAVDEAHIVTVNPLLSPYMTKVVKMWRKLGAWLWLATQNLKDFPDIAEKMLNMAE
WWICLTMPPEEVKDISRFRALTPEQEAVLLSARKLSGCYTEGVVLAKRIEALFRAVPPSL
YLALGMTEKEEKAERRALMREHHCSELDAAKLIARKLDRLRGLTDAHDEESTAA
NT seq 2865 nt   +upstreamnt  +downstreamnt
atgttttctcttttcggccgtaaaaatgaagtgaaacccgatggcacggcagggcagcca
gagggggaggtctctcctctggttattcacggccgggagccactgacgcgaccaggccgg
atgacccggcaggaagaggcaaaagtgtatcacgctaatccgtccatcattgattatctg
ccatgggtggaattcctggatgaagatcagtgtcttctgcttgaggacggtatctccgtc
ggtgccgtttatgacgtgaagccagtagccacggaagggcgcacaaatgatcgtctggag
cagatccgcgatacggtggaagatgccctgcaggacagctttgatgaatatgatgagaat
ccctgggtggtgcagttcttctgccaggatgaagatgatgctgaagcgtatctggaccac
ttacgcggctacgtgaaaccgcatgcgcagcgcacggcatttacggaggcttggctgggt
gaaatggcacgtcatatccgcagtatctcgcggccggaggggctgtttaccgatgcgttg
atcaccggtcagctgtggcgcggccagcagcgtcgcacccgtatggttatttatcgctgg
agcgggaagtccgcttcccgggacccgatgccgccggtagcgatgctcaaccaggcgtgt
gaacgtgtggtcagtgcgctgggcggggccggtattcgttgtacccgtcagaatggcctg
caggtgcacagctggctgctgcgcctgtttaatccgtctccggactgggtggataaatcc
acactctatcgtcaggcggcgtatgccgatccgcgcgacttcccggcgggcgtggcacca
gtcagcaatgattttgctgaaacgctgtggtttacgccacccgtttcggatccggagaac
ggcgtatggtggatagataataaactacattgtgctctgccggttgagagactgcgtacc
ccgccggagccaggtaccatcaccggtgaacaggcccgcggtgagaaaaaaatcaacgca
ctgatggatatgtttccagaagggacactgctgtgcatgacgattgttgtgcagccgcag
gacaggctggaagaacagttcaaccgcctgtcgaaaaatgccgtcggggagaataccgaa
tccggccgtgtccgtcaggatgtgaaaacggtgaaagagtatctgggaaaccggcataag
ctgtatcgtgccgggatcaccttccttctgcgcggtgatgatatggataatcttaagcgc
aaacgtcttgatttgaccaccgtattgcttggggccggcctgcagccggttcgatcggaa
tttgaggtggggccgctgaatacctggctgcgggcgctgccaatgtgctttaacccgaac
agcgataaaaaacattggtacacccgcctgacctgggtacagcacctggcagggttgcta
ccggttaccgggcgggaaaccggtaccggcaacccgggtttcagcttttttaaccgcggc
ggtgatattctgacgtttgatccactgaacaagtatgaccgtacccagaatgcgcatctg
ttgttgttcggaccgacgggggcaggtaaatcagccacgctgtgttatgccttttctcaa
ctgatggcggttcaccggccacgtctgtttatcgctgaagctgggaacagttttggcctg
caggctgattattttgaaagccttggactttctgtcaacaagataagcgtcaaaccgggt
agtggggtcagcctgccgccgtttgccgacgcgcataaactggtcgaagaagggctggca
gcacatgccgttgatgagagcgatctccccgatatcgatgccgacagtgacggagagggt
gaagacgaggataagcgggatattctcggtgagatggagatttcagcccgcatgatgata
acgggcggcgatccgaaagaagaagccgaaatgaagcgtgccgaccgggctatgatccgt
gaagcgctgctgatggccgcgcatgcaacatataaagaagggaggcagatgctgccttct
gacctgcagaaagcgttatacagcattgccggtgatgacagcgatgaggggcagaatgtc
cgtaatgcccagcgtaaggcgaaagccgcagagatggcggaggcgctggggatgttcact
caggaaggcagctttgaggcggagctgttcaaccgcgagggggaattgtggcctgaagcg
gatgtgaccctggtggatctcggtcatctggcgcgtgagggttatgaagcgcagatggcg
ctgaccatggtgtcaatgaccaacatgattaacaatattgcagagcgggatcagtatctc
ggccgcgatatagtcttcgcggtggatgaggcgcatattgtgacggttaatccactgctg
tcgccgtatatgaccaaagtggtcaaaatgtggcgaaagttaggggcctggctgtggctg
gccacgcagaacctgaaggacttcccggatattgcggagaaaatgctgaacatggcggag
tggtggatttgcctcaccatgccaccggaagaggtgaaagacatcagccggttccgtgca
ctcacgcctgaacaggaagccgtgctgctttccgcccgtaagctgtcaggttgctataca
gaaggggtggtgctggccaaacgtattgaggcgctgttccgtgctgttccccccagtctg
tatcttgcgctgggcatgacggagaaagaggaaaaggcggaacgccgggcgctgatgcgt
gagcatcactgtagcgaactggacgcggcgaagctgattgcccgtaaactggaccggttg
cgcggactgactgacgcacacgacgaggagagcactgcagcatga

DBGET integrated database retrieval system