KEGG   Edwardsiella ictaluri: NT01EI_0730Help
Entry
NT01EI_0730       CDS       T00912                                 

Definition
(GenBank) peptidoglycan synthetase FtsI, putative
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00550  Peptidoglycan biosynthesis
eic01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NT01EI_0730
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NT01EI_0730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
    NT01EI_0730
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eic03036]
    NT01EI_0730
Enzymes [BR:eic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NT01EI_0730
Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   NT01EI_0730
Chromosome and associated proteins [BR:eic03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    NT01EI_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACR67951
UniProt: C5B9F0
LinkDB All DBs
Position
726259..728022
Genome map
AA seq 587 aa AA seqDB search
MKAVRSGKIRRQEEQASFVSWRFALLCGCILLALLGLLARAAYLQVISPEHLVREGDARS
LRTQSIPTARGMIRDRAGRPLAVSVPVNAIWADPKEVNEHGGITLDTRWQALADALEIPL
DKMAARINTNPRGRFVYLARQVNPAMGEYIHKLRLPGIYLKQESRRYYPAGQVTAHIIGV
TNIDGQGIEGVEKSFDRWLTGQPGERTVRKDRFGRVIEDISSVDSLAAHNLSLSIDERLQ
ALVYRELTNAVAFNKAESGTAVLVDVNTGEVLAMANSPSYNPNNLTDTPQEAMRNRAITD
IFEPGSTVKPMVVMTALQRGIVRESSVLNTLPYYVNGHEIKDVARYAELSITGILQKSSN
VGVSKLALAMPSSALVETYSGFGFGRPTNLGLVGESSGIYPKKQRWSDIERATFSFGYGL
MVTPLQLARVYATIGSMGIYRPLSITKVDPPVSGERVFPVALVRSVVHMMESVALPGGGG
VKAAVKGYRVAVKTGTAKKVGPDGRYVNKYIAYTAGIAPASNPRFALVVVINDPQAGKYY
GGAVSAPVFGAIMGGVLRTMNVEPDALPTGDKSELVNNKKEGSGGRS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgcgatctgggaagatacggcgtcaagaagaacaggccagctttgttagc
tggcgttttgcgttgttgtgcggctgtatcttattggcgctgcttgggttgctggcacgc
gccgcctacctgcaggtgatcagccccgaacacttggtgcgggagggagatgcccgctcc
ctgcgtacgcaatcgatcccgaccgcgcgcggtatgatcagggatcgtgccgggcgccct
ctggcggtcagcgtgccggtgaatgcaatctgggccgacccgaaagaggtgaatgagcac
ggcggcatcacgctggacacgcgctggcaggcgctggccgatgcattggaaatcccgttg
gataaaatggccgcgcggattaacacaaacccccgcgggcgctttgtctacctagctcgc
caggtgaatccggcgatgggcgagtacattcacaagcttcgcctgccagggatctacctg
aagcaagagtcgcgtcgttactatcctgcagggcaagtgaccgctcacattatcggtgtg
accaatatcgatggccaggggattgaaggggttgaaaagagcttcgatcgctggttgacc
gggcaacccggggagcgcaccgtgcgcaaggatcgctttggccgggtcatcgaggatatc
tcctcggtcgatagcctggctgctcacaacctgtcgctgagcatcgatgagcgtctgcag
gcgttggtatatcgtgagctgaccaatgcggtggcattcaacaaggccgagtcaggtacc
gcggtgttagtggatgttaataccggggaagtgctggcaatggccaatagcccctcctat
aacccgaacaatcttaccgacacgcctcaggaggcgatgcgtaaccgcgctatcaccgat
atctttgagccgggatcgaccgtgaagcccatggtggtgatgacagccctacagcgcggc
atcgtgcgggagagcagcgtgctgaatacgctgccttactatgtcaacgggcatgagatt
aaggatgtggcacgctacgccgagctgtccattaccggtattttacagaagtcgagtaac
gtcggtgtttccaagctggcgttagcgatgccgtcctcggcgctggtggagacttactcc
ggcttcgggttcggaagaccgaccaatttggggctggtcggggaaagcagtggcatatat
ccaaaaaaacaacggtggtccgacattgagagggccaccttctctttcggatatgggcta
atggtaacgccgttacagttagctcgtgtctatgcaaccatcggcagcatggggatttat
cgcccactgtcgattaccaaggtggatccgccggtgtccggcgagcgggtgttcccggtt
gcgctggtacgtagtgtggtgcacatgatggaaagcgtggcgctgcccggaggtggcggt
gtcaaagcggcagtaaaaggttaccgggtcgccgttaagaccggtacggccaagaaggtt
gggcctgacgggcgctatgtgaataaatatatcgcctacacagccggtattgcgccggcc
agcaatccccggtttgccctggttgtggtgattaacgatccacaggcggggaaatattac
ggtggtgcggtatctgcaccggtctttggcgccatcatgggcggcgtactgcgcaccatg
aacgttgaaccggatgcgttgcccacgggtgataagagcgaattggtgaacaacaaaaaa
gagggttcaggtggcagatcgtaa

DBGET integrated database retrieval system