KEGG   Edwardsiella ictaluri: NT01EI_0738Help
Entry
NT01EI_0738       CDS       T00912                                 

Definition
(GenBank) D-alanine-D-alanine ligase B, putative
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00473  D-Alanine metabolism
eic00550  Peptidoglycan biosynthesis
eic01100  Metabolic pathways
eic01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NT01EI_0738
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NT01EI_0738
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NT01EI_0738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
    NT01EI_0738
Enzymes [BR:eic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NT01EI_0738
Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
 Precursor biosynthesis
  Amino acid ligase
   NT01EI_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_Ter ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACR67959
UniProt: C5B9F8
LinkDB All DBs
Position
737129..738031
Genome map
AA seq 300 aa AA seqDB search
MAEKVAVLLGGTSAERDVSLLSGQAVLNGLKQAGIDAYPADTRRFPATQLREAGFERVFI
ALYGRGSLQGVLEFLQLPYTGSDVMASALTMDKLRSKQVWQAAGLPVVPYVAISREQFDE
GLTMDTLHEINDLGLPLIVKPSREGSSVGMSKVSEPCEFDPALVEALRHDDEILIEKWLS
GPEYTVAFIGDEIFPSIRIQMADAFYDYEVKYLSDKAEYFCPSGLSDEQEQALVALVRRA
YKALGCSGWGRVDVIQDTSGEFCLLEANTAPGSHSLTPMAACQAGMSFSPLVVRILELAD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaagtagcggtattgttgggcggcacctctgctgaacgcgacgtttcgctg
ctgtcggggcaggcggtactgaatggtctgaaacaggccggtattgatgcttatccggct
gatacaaggcgctttcctgcaacacaattacgagaggccggttttgaacgggtatttatc
gctctgtacggccgcggcagcctgcaaggggtgctggagtttctgcagctgccctatacc
ggcagcgacgtgatggcatcggcgttgaccatggataagttgcgatccaagcaggtatgg
caggccgccgggctgcctgtggtgccctatgtcgccatcagtcgcgaacagtttgacgaa
gggctgaccatggatacgctgcacgagattaatgatctcggcctgccgctgatcgtgaaa
cccagtcgcgagggctccagcgtcggcatgagcaaagtcagcgaaccgtgcgagttcgat
ccggcgctggttgaggcgctgcgccatgatgatgagatcctgatcgaaaaatggctttcc
ggtccagaatacaccgtggccttcatcggcgatgaaatttttccgtcgatccgtatccag
atggccgacgcgttctatgattatgaggtcaagtacttatcggataaggctgagtacttc
tgtcccagcggattgagcgatgaacaggagcaggcgctggtggcgctggtacgcagggcc
tataaagcactgggttgtagcggttgggggcgggtggatgtgatccaggatacctccggt
gagttctgcctgttggaggccaatactgcaccgggtagccacagtctgactccgatggct
gcctgtcaggccgggatgagtttttcaccgttggtggtacggattttggagttagcggat
tga

DBGET integrated database retrieval system