KEGG   Edwardsiella ictaluri: NT01EI_0794Help
Entry
NT01EI_0794       CDS       T00912                                 

Definition
(GenBank) penicillin-binding protein 1B, putative
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NT01EI_0794
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eic01003]
    NT01EI_0794
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
    NT01EI_0794
Enzymes [BR:eic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NT01EI_0794
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NT01EI_0794
Glycosyltransferases [BR:eic01003]
 Polysaccharide
  Bacterial polysaccharide
   NT01EI_0794
Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NT01EI_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ACR68015
UniProt: C5BH79
LinkDB All DBs
Position
791282..793774
Genome map
AA seq 830 aa AA seqDB search
MSGDDRQPIGRKGKKRAAQPLRGEPTRRRRRYDEDDYDEDDQERGESDDDGYDDDDEGDV
AHKQVKRSRRRRVLWLLFRLALVALVVIGAYGVYLDQQIRSRIDGKVWQLPAAVYGRMVS
LEPGMNYSKKEMINLLEGMQYREVSRITRPGEFTVSGSSIDMLRRPFDFPDGKERQIHAR
LVFDEDGLSEIVNLENKRQFGFFRLDPRLITMLQSPNGEQRLFVPRSGFPTLLVDTLLAT
EDRHFYQHDGISFYSIGRALLANLTAGRTVQGGSTLTQQLVKNLFLSNERSLWRKLNEAY
MALILDYRYSKDRILELYLNEVYLGQSGNDQIRGFPLASLYYFGRPVEELSLDQQALLVG
MVKGASLYNPWRNPKLALERRNVVLHLLLEQKIIDQDLYNMLSARPLGVQPKGGVISPQP
AFMQLVRQELQAKLGDKVQDLSGVKIFTTLDPVSQDAAEKAVEAGIPALRAARHLDDLEA
AMVVVDRFSGEVRAMVGGAQTQFAGFNRAMDARRLIGSLAKPPTYLTALSEPVSYRLNTP
LTDQPVSIKLSNGTYWEPKNYDRQYRGQVMLMTALAQSLNVPTVNLGMALGLDRISATWQ
QLGVPKSVIDPVPAMLLGAINLTPMEVAQAYQTIAAGGNRATLSALRSVIAEDGTVLYQS
LPQAQSVVAPQAAYLTLYAMQQGVVSGTSRSLSGKFGRYHLAAKTGTTNDLRDSWFAGID
GKEVTITWVGRDNNGPSKLTGASGALTLYRRYLENQTPLALDLVPPQGISMVGIDAAGNF
QCGSGRTLPVWTDNPQSLCSASSSAAPVGGTSGSESDGVASWIKDMFGRN
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggacgatcgccagccaatcgggcgcaagggtaagaaacgggcggcgcagccg
ctacgcggagagcctacgcgccgtcgccgtcgttatgacgaggatgactacgacgaggat
gaccaggagcgtggggagagtgatgatgacggatatgatgatgatgatgagggtgatgtg
gcgcacaaacaggtaaaacgttcccgccgacgccgcgtgctgtggctgctgtttcgtctg
gcgctggtcgcgctggtcgttatcggcgcctacggggtctatctcgatcagcagatccgc
agccgtatcgacggtaaggtctggcagctgccggccgccgtgtatggccggatggtcagc
cttgagccggggatgaactacagcaagaaagagatgatcaatctgctggagggcatgcag
taccgcgaggtgagccgtatcacccgcccaggcgagtttaccgtctcgggcagcagtatc
gatatgctacgccgtccctttgattttcctgatggaaaagagaggcagatccacgctcgc
ctggtatttgacgaagatggcctgagcgaaattgtcaatctggagaataagcgccagttt
ggctttttccgtctcgatccccggctgattacgatgctgcagtcgcccaacggcgagcag
cgtctgtttgtgccgcgcagcggcttcccaacgctgctggtggataccctgctggcgacg
gaggatcgccacttctatcagcacgacggcatcagcttctactccattggccgtgcgctg
ctggccaacctgacggccggccgtacggtgcaggggggaagcaccctgacccagcagctg
gtgaaaaacctgttcctgagcaatgagcgctccctgtggcgcaagcttaacgaagcctat
atggcgctgatcctcgattatcgctacagcaaggatcgcattctggagctgtacctcaac
gaggtgtacctggggcagagcggcaacgatcagatccgcggtttcccgctggccagcctg
tattactttggccgcccggtcgaagagctgagcctggatcagcaggcgctgctggtgggc
atggtcaagggggcatcgctgtataacccgtggcgcaatcccaagctggcgctggagcgg
cgcaatgtggtgctgcatctgctgttggagcagaagatcatcgatcaggatctgtacaac
atgctcagcgcccgtccgctcggggtacagcccaaggggggagttatctcgcctcagcct
gcgtttatgcagctggtgcgccaggagctgcaggccaagcttggcgataaggtacaggat
ctctccggggtgaagatctttaccaccctcgatcctgtctcgcaggatgcggcggaaaaa
gccgtcgaggccggtattccggcgctgcgcgctgcgcgccacttagatgatctggaggcg
gccatggtggtggtcgatcgcttcagcggcgaggtgcgtgcgatggtgggcggcgcgcag
acccagtttgccggctttaaccgtgcgatggacgcccgtcgtctgatcggctcgctggcc
aagccgccaacctatctgacggcgctgagtgagccggttagctatcgcctgaataccccg
ctgacggatcagccggtgtcgatcaagctctccaacggcacctactgggagccgaaaaac
tacgatcgtcagtaccgtggacaggtgatgctgatgaccgcgctggcgcagtcgctcaac
gtaccgacggtgaatttgggcatggcgctggggctggacaggatcagtgcaacctggcaa
cagctgggcgtcccgaagagcgtcattgatccggttcccgccatgctgctgggcgcgatc
aacctgacgccgatggaggtggctcaggcctatcagaccatcgccgccggtggtaatcgg
gcgacgctgtcggcgttgcgttcggtgatcgccgaggacggcaccgtactgtatcagagt
ttgccccaggcccagagcgtggtggccccgcaggcggcctacctgacgttgtatgccatg
cagcagggggtggtgagcggaacctcgcggtcgctgtcggggaagtttggtcgttaccat
ctggcggccaagaccggtaccacgaacgatctgcgcgatagctggtttgccggtattgac
gggaaggaggtcacgatcacctgggttggacgcgataataacggcccctccaagttgacc
ggggccagcggtgccctgaccctgtaccgtcgctatctggagaatcagacgccgctggcg
ttggatttggtgccgccgcaggggattagcatggtggggatcgatgctgccggtaatttc
cagtgcggcagcgggcgaacccttccggtctggaccgacaatccgcagtcgctgtgcagt
gcctcctcatcggcggcgcctgtcgggggtacgtcaggcagtgaaagtgatggtgtcgcc
agttggatcaaggatatgtttggtcgcaactga

DBGET integrated database retrieval system