KEGG   Edwardsiella ictaluri: NT01EI_0906Help
Entry
NT01EI_0906       CDS       T00912                                 

Definition
(GenBank) glutamate decarboxylase, putative
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00250  Alanine, aspartate and glutamate metabolism
eic00410  beta-Alanine metabolism
eic00430  Taurine and hypotaurine metabolism
eic00650  Butanoate metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NT01EI_0906
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NT01EI_0906
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NT01EI_0906
   00430 Taurine and hypotaurine metabolism
    NT01EI_0906
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NT01EI_0906
Enzymes [BR:eic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NT01EI_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: ACR68120
UniProt: C5B9L8
LinkDB All DBs
Position
complement(905040..906434)
Genome map
AA seq 464 aa AA seqDB search
MKKGHDIHGKLLDSRFGSEAIRSAAEAHYFPLEEMREDIAFQVINDELLLDGNARQNLAT
FCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPHPADGQAVGTN
TIGSSEACMLGGMAMKWRWRAKRLAQGKPVDKPNMVCGPVQVCWHKFARYWDIELREIPM
APGKLFMDPERMIAACDENTIGVVPTFGVTYTGNYEMPDVLHKALDDLQARTGLDIDMHI
DAASGGFLAPFCAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVVWRDAASLPDDLIFK
VDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYAKVHTASYQVAQFLAAEIARLEP
YEFICNGDPQQGIPAVCFRIPAGKELGYSLYDLSERLRLRGWQVPAFALSGEMSDVVVMR
IMCRRGFEMDFAQLLMDDFRAALAYLKAHPAAAHIANQNSFKHS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtcatgatattcatggaaagctcttagattcccggtttggctctgaagcg
atccgttctgcagccgaggcgcactatttcccgctggaagaaatgcgcgaagatattgct
tttcaagttattaacgatgagctgcttttagacggtaatgcccggcaaaacctggcgacg
ttttgccagacctgggatgacgattatgtacatcgcctgatggatatttcgatcaataaa
aactggatcgataaagaggagtatccgcagtctgccgcaatcgatctgcgctgcgtcaac
atggtggccgatctgtggcatgcgccgcatccggcggacggacaggctgtcggtaccaat
actatcggctcttccgaggcctgtatgctgggcggcatggcgatgaagtggcgctggcgc
gccaaacgtctggcgcaggggaaaccggtggataaacccaatatggtgtgcgggccggtg
caggtctgctggcataagttcgcccgctactgggatatcgaactacgcgagatcccgatg
gcgcccggcaagctgtttatggatccggagcggatgatcgccgcctgcgatgagaacacc
atcggcgtcgtgccgacctttggcgtcacctacaccggcaactacgagatgcctgacgtg
ctgcacaaggcactggacgatctgcaggcgcgtaccggactggatatcgacatgcacatc
gatgctgccagtgggggcttcctggcaccgttctgcgccccggatatcgtctgggacttc
cgtctgccgcgggtcaaatccatcagcgcatccggccataagttcggcctggcaccactc
ggctgcggctgggtggtatggcgtgacgccgcctccctgccggacgatctgatctttaag
gtggactatctgggcggacaggtcggtacctttgccattaacttctcccgtcccgcgggt
caggttatcgcacagtactatgagttcctgcgtctggggcgcgagggctacgccaaggtg
cataccgccagctatcaggtggcgcagttcctggcggcggagatcgccaggctggagccc
tatgagtttatctgcaacggcgatccgcagcagggtatcccggcggtgtgcttccgcatt
ccggccggcaaggagctgggctatagcctgtacgatctctctgagcgcctgcgcctgcgc
ggctggcaggttccggcctttgcgttgagcggtgaaatgtccgatgtggtggtgatgcgc
atcatgtgccgccgcggatttgaaatggactttgcccagctgttgatggacgactttcgc
gcggcactggcctatctcaaggcccatccggcagcggcacatatcgccaatcagaacagc
ttcaaacattcctga

DBGET integrated database retrieval system