KEGG   Edwardsiella ictaluri: NT01EI_0991Help
Entry
NT01EI_0991       CDS       T00912                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacD, putative
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00550  Peptidoglycan biosynthesis
eic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NT01EI_0991
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eic01002]
    NT01EI_0991
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
    NT01EI_0991
Enzymes [BR:eic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NT01EI_0991
Peptidases and inhibitors [BR:eic01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   NT01EI_0991
Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   NT01EI_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACR68204
UniProt: C5BBG9
LinkDB All DBs
Position
983345..984508
Genome map
AA seq 387 aa AA seqDB search
MNTVAKIPLALLLLAGAAQAQMAFPLVPPHIDAASWVLMDAQTGQILAAGNPDARRNPAS
LTKLMTNYVVERALDQGRIGLNDRVSIGDDAWATRNPLFKGSSLMFLKPGDHATVSDLIR
GIIIDSGNDACVALSDYVSGDQADFVRQMNAYVNALHLQNTHFETVHGLDAPGQYSSARD
LALLARAIITHEQPYYHFYAEKSLSWNGVTQNNRNGLLWDQDLHVDGMKTGHTASAGFNL
VATSVDARGQRLIAVVMGADSSRGREVQAKKLLLWGDRNFETVQLAASDKAVTCQQVRYG
QQQTVALGSPQNIYYTLPKGELRDVKVEYTLSHDYLKAPLAKGEVVGQVDYLYGGKKIGS
YALRTLTPVAEAGWFSRLEDYIAIKIG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacagttgccaaaatcccgctggccctcttactgcttgccggtgccgcccaggca
cagatggcctttcctctggtgccgccccatatcgatgccgcctcctgggtactgatggat
gcccagaccggacagatcctggctgccgggaacccggatgcccggcgtaacccggccagc
ctgaccaagctgatgaccaactacgtggtggagcgggcgctggatcagggacggatcggg
ctcaacgatcgcgtatcgatcggcgatgacgcctgggcgacccgcaatccgctgtttaag
ggatcgtcgctgatgttcctcaagccgggggatcacgcgacggtcagcgatctgatccgc
gggatcatcattgactccggcaacgacgcctgcgttgccctgtctgactatgtcagtggg
gatcaggccgattttgtccgtcagatgaacgcctatgtcaatgcgctgcacctgcagaat
acccactttgaaacggtgcacggtctggatgcacccgggcagtacagcagcgcgcgcgat
ctggcgctgttggcccgtgccatcattacccatgagcagccctactaccatttttatgcg
gaaaagagcctgagctggaacggggtgacccagaacaaccgtaacgggctgctgtgggat
caggatctgcacgtggacgggatgaagaccggccatactgccagcgccggtttcaatctg
gtggccaccagcgttgacgcccgcggtcagcgtctgatcgccgtggtgatgggggccgac
agcagccgcgggcgtgaggtgcaggcaaagaaactgctgctgtggggcgatcgtaacttt
gagaccgtgcagctggcagccagcgataaagcggtgacctgtcagcaggtgcgctatggt
cagcagcagaccgtggcgctgggcagcccgcagaatatttactataccctgccgaagggc
gagctgcgcgacgtgaaggtggagtacaccctgagccatgactatctgaaggcgccgctg
gcgaagggcgaggtcgtcgggcaggtggactacctgtacggcggcaagaagatcggcagc
tatgcgctgcgaacgctgacccccgtcgccgaggccgggtggttctcccgtcttgaggac
tatatcgcgattaagatcggctga

DBGET integrated database retrieval system