KEGG   Edwardsiella ictaluri: NT01EI_1223Help
Entry
NT01EI_1223       CDS       T00912                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
eic  Edwardsiella ictaluri
Brite
KEGG Orthology (KO) [BR:eic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NT01EI_1223
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     NT01EI_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ACR68431
UniProt: C5B7C5
LinkDB All DBs
Position
1218929..1220044
Genome map
AA seq 371 aa AA seqDB search
MSQCCGANAVTVREGIPATMQAVVAYAPHDYRLEEVAVPTIGEGEILVKVEACGICAGDT
KAFEGAASFWGDETQPAYIKAPMIPGHEFIGHVVGFGAGVVDFALGDRVIAEQIVPCWSC
RFCQRGQYWMCEKHDLYGFQSNVNGGMAEYMKFTPQSINYRIPDDLPMEKAILIEPYACS
FHAVQRAKIQLGDTVVLAGAGTLGLGMIGAIKKSGAGRLIVLDLSDERLALAQKFGADRV
LNPARDDVVSIVKTMTDGYGCDVYIEATGAAASVEQGLRMIRKLGTFVEFSVFKEPVSVD
WSIISDRKELDVLGSHLGPYCYPLVIEGIANGDLPTEGVVTHVLPLSQFAEGFALMQRGV
GSIKVVLNPNL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtgttgcggagcaaacgcggtaacggtgcgcgaggggatcccagcgacgatg
caagcggtggtggcatatgccccccacgactaccgtttggaggaggtcgccgttccaacg
attggtgagggtgagatcttggtgaaggtggaggcctgcggtatctgcgccggtgacacg
aaagcctttgaaggggcggccagcttttggggagatgagactcagccggcctacatcaaa
gcgcccatgatcccgggtcatgaatttattggtcatgtcgttgggttcggcgctggcgtg
gtggattttgcgctaggcgatcgggttatcgcggagcagatcgtaccgtgctggtcatgc
cggttttgtcagcgcggtcagtactggatgtgtgagaagcatgacctgtatggctttcag
agcaacgtgaatggcggaatggcggaatatatgaaatttacgccgcagtccatcaattat
cggatccccgacgatctgccgatggagaaagcgattctgattgagccctacgcctgttca
ttccatgcggtacagcgcgcgaagatccagctgggggatacggtggtattagcgggtgcc
gggaccctggggctggggatgattggcgcgattaaaaagtcaggggcgggcagactgatt
gttctggacctgtcagacgagcgtttggccctcgcgcagaaatttggcgccgatcgggta
ctcaatccggcccgggatgacgtcgtatccatcgttaaaacgatgaccgacgggtatggc
tgcgatgtgtatatcgaggcaacgggagccgcggcgtcggttgaacaagggctacggatg
atccgtaagctggggacattcgttgagttttcggtatttaaggagccggtgagcgtggac
tggagcattatcagcgatcgtaaagagctggatgtgctggggtcacaccttggcccctat
tgctatccgctggtgatcgagggaattgccaatggcgatttacctaccgagggcgtagta
acgcatgtcctgccgttatcgcagtttgccgagggatttgcactcatgcagcgcggcgta
ggctcaattaaggttgtgctgaatccaaatctataa

DBGET integrated database retrieval system