KEGG   Edwardsiella ictaluri: NT01EI_2094Help
Entry
NT01EI_2094       CDS       T00912                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00480  Glutathione metabolism
eic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NT01EI_2094
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eic02000]
    NT01EI_2094
Enzymes [BR:eic01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NT01EI_2094
Transporters [BR:eic02000]
 Other transporters
  Pores ion channels [TC:1]
   NT01EI_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ACR69270
UniProt: C5BE29
LinkDB All DBs
Position
2016271..2016876
Genome map
AA seq 201 aa AA seqDB search
MKLFYKSGACSLSPHIILREAGLDFTIESVDLANKRTEHGRDYLSINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRCLIPPQETLARYHAIEWLNYIASEIHKGFSPLFNPRQPQE
SKAIARAALEKQFHYLNGVLSERPYLLGPSFSVADAYLFTTLCWAKAMHFDLTAWPVLAD
YMTRIAARPAVDATLCAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaatccggggcctgctctctctcaccgcacatcatactgcgtgag
gccggtctggatttcaccattgaaagcgtggatctggccaacaagcgtaccgagcacggc
agagactatctaagcattaatcccaaggggcaggtaccagcgctgctgctggacgacggc
agtctgctgaccgaaggggtagccattgtgcagtacctggccgatcgggtaccagaccgc
tgtcttatcccgccgcaggagacgctggcgcgctatcacgcgatcgaatggctcaactat
attgccagcgagatccataaggggttcagcccgctgttcaatccgcgccaaccgcaggag
agcaaggcgatagcgcgcgcagcgctggagaagcagttccactacctcaacggcgtactc
agcgagcggccctacctgctggggcccagcttcagcgtcgccgacgcctatctattcacc
acgctgtgctgggccaaggcaatgcacttcgatctgacagcctggccggtgctggccgac
tatatgacgcgtattgccgcgcggccggcggtcgatgccacgctctgcgccgaggggttg
aagtag

DBGET integrated database retrieval system