KEGG   Edwardsiella ictaluri: NT01EI_3715Help
Entry
NT01EI_3715       CDS       T00912                                 

Definition
(GenBank) formate dehydrogenase, nitrate-inducible, iron-sulfur subunit, putative
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
eic  Edwardsiella ictaluri
Pathway
eic02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NT01EI_3715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_6 Fer4_2 Fer4 Fer4_17 Fer4_4 Fer4_16 Fer4_3 Fer4_20
Motif
Other DBs
NCBI-ProteinID: ACR70843
UniProt: C5BB01
LinkDB All DBs
Position
3601589..3602542
Genome map
AA seq 317 aa AA seqDB search
MSQQSQDIIKRSATNSLTPPPNGRNHQEEVAKLIDVTTCVGCKACQVGCSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSEVEENGKLEWLIRKDGCMHCADPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNVPRMNPEDKRVYKCTLCVDRVTVGQEPACVKTCP
TGAIHFGTKAAMKTLAAERISELQGRGFADAGLYDPPGVGGTHVMYVLHHADRPELYHGL
PKDPHIDTPITLWKDVLKPVAFAGFIATFIGLLYHYIAVGPNTEDADDHGDTPRGNAGGQ
EHSQKQGHAEENHHEQK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagcaatcccaagacattattaagcgttcggccaccaattccctgacgccgccc
cccaacgggcgcaatcaccaggaggaagtggccaagcttatcgacgtgaccacctgcgtc
ggctgtaaggcctgtcaggtgggctgttcagagtggaacgatatccgggatgaggtcgga
cactgcgtcggggtgtatgacaaccccgccgatctgagcgccaagtcctggacggtgatg
cgcttctcggaggtcgaggagaacggtaagctggagtggctgatccgtaaggatggctgc
atgcactgtgccgatccgggctgcctgaaggcctgtccgtcggcaggcgccatcatccag
tacgccaacggtatcgtcgactttcagtccgagcactgcatcggctgcggctactgcatc
gccggctgcccgttcaatgtgccgcgcatgaatccggaagacaaacgggtgtacaagtgc
accctgtgcgtcgaccgcgtcaccgtcggccaagagccagcctgcgtcaaaacctgcccg
accggcgccatccactttggcaccaaggcggcgatgaagacgctggcggccgagcgcatc
agcgagctgcagggccgcggcttcgccgatgccggcctgtacgatccgccgggcgtcggt
ggcacccacgtgatgtatgtgctgcaccacgccgaccggcccgagctgtaccacgggctg
ccgaaggatccgcatatcgatacccccatcacgctgtggaaggatgtgctcaaaccggtc
gcctttgccggtttcatcgccacctttatcgggctgctgtaccactacatcgccgtcggc
cccaatacggaggacgcagacgatcacggcgatacgccgcggggtaacgctggcgggcag
gagcatagccagaagcaaggacatgcagaggagaatcaccatgagcaaaaataa

DBGET integrated database retrieval system