KEGG   Edwardsiella ictaluri: NT01EI_3744Help
Entry
NT01EI_3744       CDS       T00912                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00473  D-Alanine metabolism
eic00550  Peptidoglycan biosynthesis
eic01100  Metabolic pathways
eic01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NT01EI_3744
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NT01EI_3744
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NT01EI_3744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
    NT01EI_3744
Enzymes [BR:eic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NT01EI_3744
Peptidoglycan biosynthesis and degradation proteins [BR:eic01011]
 Precursor biosynthesis
  Amino acid ligase
   NT01EI_3744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: ACR70871
UniProt: C5BB29
LinkDB All DBs
Position
3630850..3631953
Genome map
AA seq 367 aa AA seqDB search
MAKIRVGIVFGGQSCEHEVSLQSAKNIVEAIDQSRFDVTLIGIDKQGYWHLCSGQDYLNH
AHDPQHIALNHSERRLAVIPGAIQGQLIDSVSGEILPSLDVIFPIVHGTLGEDGCLQGML
KMLNLPFVGSDVIGSAACMDKEVCKRLLRDAGLPITPFVTLTRATQTHYNYETLRSQLGE
TLFVKPANQGSSVGVNKVRNADEYHRAIADALRFDHKVIVERGVIGHEIECAILGNEVAQ
ASVCGEIVLHSDFYSYDSKYISAQDAQVVVPAAMAPEVSERVRQTALRAFQALECRGLAR
VDVFVTAENEVIINEINTLPGFTNISMYPKLWQASGISYQALITQLIELALERHRVDSQL
CRATGSL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattcgcgttggcattgtgttcggcggtcaatcctgcgagcacgaggtttct
cttcaatcagcaaaaaatattgtcgaagcgatcgatcaatcacgttttgacgtaacactt
atcggtatcgacaagcagggatactggcatctatgcagcgggcaggactacctgaaccat
gcccatgacccacagcatatcgccctgaatcattcagaacgccgtctggcggtgatcccc
ggagcaatccagggacagcttatcgatagtgtcagcggtgaaattctaccctcgctggac
gttatttttcccatcgtacacggcacgctgggcgaggatggctgcctgcagggtatgctg
aaaatgctgaacctgccctttgtcggatccgacgtcatcggctccgctgcctgcatggat
aaagaggtatgcaaacgcctgctgcgcgatgcaggcttgccgatcacccccttcgtcacg
ctgacccgcgccacgcagacccactacaactatgagacgctgcgcagccagctgggcgag
acgctgtttgtcaagccggccaaccagggctcctccgtcggcgtcaacaaggttcgtaac
gcggatgagtatcaccgcgcgattgccgatgcgctgcgcttcgatcataaggtaatcgtc
gaacgcggagtgattgggcatgagattgaatgcgccatcctcggtaacgaggtggcgcag
gccagcgtctgtggcgagatcgtcctgcacagcgacttttattcctatgacagcaagtac
atcagcgcacaagatgctcaggtggtcgtgccggcagcgatggcgcccgaagtcagcgag
cgcgtccgtcaaaccgccctacgggcgtttcaggcgctggagtgccgcggtctggcacgc
gtcgatgtctttgtaaccgcagagaatgaagtcattatcaatgagatcaacacactgcct
ggatttaccaatatcagtatgtatcccaaactgtggcaggccagcggtatcagctatcag
gcgctgatcacccagctgatcgagctggcgctagagcgccaccgcgtggacagccagctg
tgccgggcgacaggcagcctctaa

DBGET integrated database retrieval system