KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_2320
Entry
ECOK1_2320        CDS       T01997                                 

Definition
(GenBank) zinc-containing alcohol dehydrogenase family
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Pathway
eih00052  Galactose metabolism
eih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECOK1_2320
Enzymes [BR:eih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     ECOK1_2320
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH 2-Hacid_dh_C 3HCDH_N UDPG_MGDP_dh_N Methyltransf_25 PrmA ELFV_dehydrog TrkA_N MTS ThiF
Other DBs
NCBI-ProteinID: ADE89617
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2390844..2391884)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKYQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDVVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGLAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSLEMSAPQMQGVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSTTFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaatatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggtcatgaa
tttagcggctatattgatgcggtgggatccggtgttgatgatttacaccctggcgatgtg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtttgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcgcggcgtgatggtggacttgctgaatat
attgtcgttaagcgaaaaaatgtctttgctctacccacggatatgcctattgaggatggg
gcttttattgagccgattaccgttggcctgcatgcttttcatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggctattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagccttgaaatgagcgcgccgcaaatg
cagggcgttttacgcgagctgcgctttaatcagcttatcctcgagacggctggcgtcccg
caaactgtcgaactggcggtagagattgccgggcctcatgcccagctggcgctggtgggc
acgttgcatcaggatctgcatttaacatcgacaacgtttggcaaaatattacgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcgcccaggcggtgcgtgacatcgctcgtaatgctatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system