KEGG   Escherichia coli O18 K1 H7 IHE3034 (ExPEC): ECOK1_2769Help
Entry
ECOK1_2769        CDS       T01997                                 

Gene name
maeB
Definition
(GenBank) malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
eih  Escherichia coli O18:K1:H7 IHE3034 (ExPEC)
Pathway
eih00620  Pyruvate metabolism
eih01100  Metabolic pathways
eih01120  Microbial metabolism in diverse environments
eih01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECOK1_2769 (maeB)
Enzymes [BR:eih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     ECOK1_2769 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ADE92856
LinkDB All DBs
Position
complement(2840976..2843255)
Genome map
AA seq 759 aa AA seqDB search
MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKY
TARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFI
EVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRV
VEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAY
AVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKE
VRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQS
EVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKL
TEFVYKTNLFMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIE
MRIQKLGLQIKSGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIG
AIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYV
NDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRERAP
ELMIDGEMHGDAALVEAIRNDRMPDSPLKGSANILVMPNMEAARISYNLLRVSSSEGVTV
GPVLMGVAKPVHVLTPIASVRRIVNMVALAVVEAQTQPL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccagttaaaacaaagtgcacttgatttccatgaatttccagttccagggaaa
atccaggtttctccaaccaagcctctggcaacgcagcgcgatctggcgctggcctactca
ccaggcgttgccgcaccttgtcttgaaatcgaaaaagacccgttaaaagcctacaaatat
accgcgcgcggtaacctggtagcggtgatctctaacggtacggcggtgctggggttaggc
aacattggcgcgctggcaggcaaaccggtgatggaaggcaagggcgttctgtttaagaaa
ttcgccgggattgatgtatttgacattgaagttgatgaactcgacccggacaaatttatt
gaagtcgtcgctgcgctcgaaccgaccttcggcggcatcaacctcgaagacattaaagcg
ccagaatgtttctatattgaacagaaactgcgcgagcggatgaatattccggtattccac
gacgatcagcacggcacggcaattatcagcactgccgccatcctcaacggcttgcgcgtg
gtggagaaaaacatctccgacgtgcggatggtggtttctggcgcgggtgccgcagcaatc
gcctgtatgaacctgctggtagcgctgggtctgcaaaaacataacatcgtggtttgcgat
tcaaaaggcgttatctatcagggccgtgagccaaacatggcggaaaccaaagctgcatac
gcggtggtggatgacggtaaacgtaccctcgatgatgtgattgaaggcgcggatattttc
ctcggctgttccggcccgaaagtgctgacccaggaaatggtgaagaaaatggcccgtgcg
ccaatgatcctggcgctggcgaacccggaaccggaaattctgccgccgctggcgaaagaa
gtgcgtccggatgccatcatctgtaccggccgttccgactacccgaaccaggtgaacaac
gtcctttgcttcccgtttatcttccgtggcgcgctggacgttggcgcaaccgccatcaac
gaagagatgaaactggcggcggtacgcgcgattgcagaactggcccatgcggaacagagt
gaagtggtggcttcagcgtatggcgatcaggatctgagctttggtccggaatacatcatt
ccaaaaccgtttgatccgcgcttgatcgttaagatcgctcctgcggtggcgaaagcggcg
atggagtcgggcgtggcgacgcgtccgattgctgatttcgacgtctacatcgacaagctg
acagagttcgtttacaaaactaacctgtttatgaagccgattttctcccaggctcgcaaa
gcgccgaagcgcgtagttctgccggaaggggaagaggcgcgcgttctgcatgccactcag
gaactggtaacgctgggactggcgaaaccgatccttattggtcgtccgaacgtgatcgaa
atgcgcattcagaaactgggcttgcagatcaagtcgggcgttgattttgagatcgtcaat
aacgaatccgatccgcgctttaaagagtactggaccgaatacttccagatcatgaagcgt
cgcggtgtcactcaggagcaggcgcagcgtgcgctgatcagtaacccgacagtgatcggc
gcgatcatggttcagcgtggcgaagccgatgcaatgatttgcggtacggtgggcgattat
catgaacactttagcgtggtgaaaaatgtctttggttatcgcgatggcgttcacaccgca
ggtgcaatgaacgcgctgctgttgccgagtggtaacacctttattgccgatacctacgtc
aatgatgagcctgatgcagaagagctggcggagatcaccttgatggcggcagaaactgtt
cgtcgttttggtattgaaccgcgtgtggctctgttgtcgcactccaactttggttcttct
gactgcccgtcgtcgagcaaaatgcgtcaggcgctggaactggtcagggaacgtgcgcca
gaactgatgattgatggtgaaatgcacggcgatgcagcgctggtggaagcgattcgcaac
gaccgtatgccggacagccctttgaaaggttccgctaatattctggtgatgccgaacatg
gaagctgcccgcattagttacaacttactgcgcgtttccagctcggaaggtgtgactgtc
ggtccggtgctgatgggcgtggcgaaaccggttcacgtgttaacgccgatcgcatcggta
cgtcgtatcgtcaacatggtggcgctggccgtggttgaagcgcaaacccaaccgctgtaa

DBGET integrated database retrieval system