KEGG   Escherichia coli IHE3034: ECOK1_3028Help
Entry
ECOK1_3028        CDS       T01997                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
eih  Escherichia coli IHE3034
Pathway
eih00250  Alanine, aspartate and glutamate metabolism
eih00280  Valine, leucine and isoleucine degradation
eih00410  beta-Alanine metabolism
eih00640  Propanoate metabolism
eih00650  Butanoate metabolism
eih01100  Metabolic pathways
eih01120  Microbial metabolism in diverse environments
Module
eih_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECOK1_3028 (gabT)
   00650 Butanoate metabolism
    ECOK1_3028 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECOK1_3028 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ECOK1_3028 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECOK1_3028 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eih01007]
    ECOK1_3028 (gabT)
Enzymes [BR:eih01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECOK1_3028 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECOK1_3028 (gabT)
Amino acid related enzymes [BR:eih01007]
 Aminotransferase (transaminase)
  Class III
   ECOK1_3028 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADE92573
LinkDB All DBs
Structure
PDB: 

Position
3101107..3102387
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHTEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYNNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcggtgaaa
atcgcccgcgccgccactaaacgtagcggtactatcgcctttagcggtgcgtatcacggg
cgcacgcattacacactggcgctgaccggcaaggtgaatccatactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctatgccggt
aacccgattgcctgcgtagcggcgctggaagtgttaaaagtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaaactgaaagacggattgctggcgatagccgaa
aaacatactgagatcggcgacgtacgcgggctgggagcgatgattgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgccaaactcaccgccgagatcgtggcgcgtgcc
cgcgataaaggcctgattcttctctcctgcggcccgtataacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system