KEGG   Encephalitozoon intestinalis: Eint_080150Help
Entry
Eint_080150       CDS       T02238                                 

Definition
(RefSeq) cell division protein kinase
Organism
ein  Encephalitozoon intestinalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase RIO1 APH Kdo Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 9698135
NCBI-ProteinID: XP_003073311
UniProt: E0S8F7
LinkDB All DBs
Position
VIII:15246..16055
Genome map
AA seq 269 aa AA seqDB search
MTRYILGGIIGSGTYGEVYEAIDTETKEKVALKRIKLNEKEGMPGTALREISILKKLNHK
NIISLVSIIHTDALLTMVFPFIDYELKKYIGMNTGKNIMELVNQLICGVHYLHQMNVVHR
DLKPQNILVTSDGVLKIADFGLSRSLEIRVPPYSSEVVTLWYRSPELLMGSTSYRFYVDI
WSLGCIIYEMITLEPLFPGESKENQLTLIRRKAGTRRSLKHAIEKKLTAPKFVVDIILRC
LDFNYDQRITADEIVEILENEYGTRGGIS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaagatacatcttaggcggaataatcggatcgggaacatatggtgaggtgtacgag
gcaatagacacagaaacgaaggaaaaggttgccttgaagagaataaagctcaatgagaag
gaaggaatgccagggactgcccttagggaaatatcaatactcaagaaacttaaccacaaa
aacatcataagcttggtgtctataatacataccgatgcactcttgacaatggtgtttccg
ttcatagactatgagttgaaaaagtatattgggatgaacacagggaaaaacataatggag
cttgttaaccagttgatatgtggagtacactatttacatcaaatgaatgtagtgcacagg
gatcttaagcctcagaacatccttgtcacgagtgatggagtattgaagatagccgatttc
ggactgtcgagaagcctggagataagagtgccaccctattctagtgaagttgttactttg
tggtacaggtcgcctgagcttcttatggggagcactagttacagattttatgtggacata
tggagtctaggatgcataatctacgagatgataacgctagaacctctctttcctggagag
agcaaggaaaatcagctaacactcatccgaagaaaggcaggaacaaggagatctctcaag
catgcaatagagaaaaagttaacagctccaaagtttgtggtcgatattatactcagatgc
ctcgacttcaactacgatcaaagaataacagcagacgagatagtggagattcttgaaaac
gagtacggaactcgcggagggatttcttag

DBGET integrated database retrieval system