KEGG   Entamoeba invadens: EIN_065890
Entry
EIN_065890        CDS       T04133                                 

Definition
(RefSeq) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
eiv  Entamoeba invadens
Pathway
eiv00620  Pyruvate metabolism
eiv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EIN_065890
Enzymes [BR:eiv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     EIN_065890
SSDB
Other DBs
NCBI-GeneID: 14883196
NCBI-ProteinID: XP_004183650
UniProt: A0A0A1TVB3
LinkDB
Position
Unknown
AA seq 1150 aa
MFNQEKGTDYPVINQTDLESLADLKLSVMGHEYPKTTKNSDAIEVMTPLVDVIAEADQDV
TAPIDQRLQSFLNSYFAECKTEIPKIPDNTVVLDKEGLGRVLSFPPNKQDFFCETMSSYK
IKQGVLHNPAKDKRTTVGVFHICEGDVPVPTDKIECPKSAFLRMLKAAFYEAPDNHLIIP
YTAECEHPTKSWVSLYMRPTVIPAVQGVKGFEHEKKTEIHFFVPGNMVSCLDFVESVFGN
AGNPKLLKNDAALDPLNWTGHTGMAVLAPHLTKITKKECGLPHISQATERQKKEHMCWEK
EDELYNDGKTFKMYARDASGFICTIIADNYFGYCKKEVKTQISFSANLYGLAEEEHAGGA
ICRPSYDLGESAKAVQYAEGYKYSEMIEKNKNSITLKEGYAVDKTYPEGIIYVPEDAVFN
IEEASIKFHYNGKEQTILLIPKVNYVLPNGYTIILHDTMTSRRWTLRGILPQYTLCHKPC
TVSGGGKSEISKNISDAIFAGKIFINNKEEEYKKVQKVFDHDFSRRYADGEIKSAHILDP
NVTLGTVVKMLTPSANFTEEHNEFIQTIQPSIVELILTIKSLYREEWKGDWQSRITVDKI
NGQEGHELKYRKMPLPSQYLRIGFESDETTWRVFQLRKDFFPAAKLQMEDDITGSVIVPT
KLLKTPINTNGKRACKIVKNCEYRLFQRPDDAIFRGYDKQTEYDFSIEGHFISNYQPMTR
EEAADFTKDVVRLYQYTDPMRVTLQDFVAGKDQTKYVVSSSLPRLVKEGDKLVCSKNPRY
LQRRPDMLDPENTYMTFKAISLFRKIADTDPLYTPVDAVLSGRRNNPPQTKGALVLRPLS
VFAPLHYFELPELLMEAITSMTGASPSIFGAGSEGALTKGPFNSLPAVVDLNNYLLGMIC
CGYSGFVSSASYCGPHYKISHDISLLIPEIWSRMRRNEQEPKYLIEHGFLEAVPDVSYNG
KTYAGRRLGYRITKEFATHFFSSIFTAPNSVMPEDFLKPEKQDLAIYADSYEYMAQTDKG
IAGNYIEDGTVEGACPPLKALLYIMANGSYNGMTIESKEFRDLFDPKAVFASEWYKLRLQ
TRQKVEEKKLNKDLTYLNKMLANRPRIADKINEQIKEVKEELAYISSEQYLQDIDGSIGT
DPYLYTCKKH
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgttcaatcaagaaaaaggtactgattacccagttatcaaccagacagacctcgagtca
cttgctgacttgaagctctctgttatgggtcatgaatatccaaagaccactaaaaacagt
gatgccatcgaagttatgacaccattagtagatgtcattgcagaagccgaccaagacgtt
accgcaccaattgatcaacgacttcaatcattcttgaattcatacttcgccgaatgcaag
actgaaataccaaagatcccagacaacacagtcgttcttgataaagagggtcttggaaga
gttttgtcattccccccaaacaaacaagacttcttctgtgagactatgtcctcatacaaa
atcaaacaaggtgtcttgcacaacccagccaaagataagagaacaacagttggtgtgttc
cacatctgtgaaggtgatgtccccgttcctactgacaagattgaatgccccaaatccgct
ttcttaagaatgttgaaagctgcattctatgaagctccagacaaccatttgattattcca
tacactgctgaatgtgaacatccaaccaaatcatgggtctcactctatatgagaccaaca
gtcattccagctgttcaaggtgttaaaggttttgaacacgaaaagaagaccgaaattcac
ttctttgttccaggcaacatggtttcctgcttggactttgttgagtctgtctttggcaat
gctggtaaccccaagttattgaagaacgatgctgcacttgacccattgaactggactgga
catactggtatggctgtccttgctccacacttgactaagatcactaagaaggaatgtggt
cttccacacatttcacaagccactgagagacaaaagaaggagcacatgtgctgggaaaaa
gaagacgaattgtacaacgacggaaagacctttaagatgtatgccagagatgcttcaggt
ttcatttgcactatcattgctgataactactttggctattgcaagaaggaagttaagacc
caaatttcattctcagcgaacttgtacggacttgccgaagaagaacacgccggtggagcc
atttgcagaccatcatatgatcttggggaatcagccaaagctgttcaatatgctgaaggg
tacaaatacagtgagatgatcgagaagaacaagaactcaattacattaaaagaagggtat
gctgttgataaaacttatccagaaggtattatatatgtcccagaagatgccgtattcaat
attgaagaggcttctattaagttccattacaacggaaaggagcaaaccattcttttgata
ccaaaagtcaattatgtccttcctaatgggtatactatcatcttacacgacactatgact
tcaagaagatggactttgagaggaattctgccacaatacacactctgccataagccgtgc
actgtctctggtggaggaaagtccgagatttctaagaacattagtgacgccatttttgct
gggaagatcttcattaataacaaggaagaagaatataagaaggtccaaaaggtctttgac
cacgacttctcaagaagatatgccgatggagaaattaagtctgcacacattctcgatcca
aatgtcacgcttgggacggttgtcaagatgttgacaccatcagcgaacttcactgaagaa
cacaatgagttcattcagaccatccaaccatctattgttgaattgatcttaacgatcaaa
tcgttgtacagagaagaatggaagggcgactggcaatcaagaatcactgtcgataagatc
aatggacaagaaggccacgaattgaaatacagaaagatgccacttccttcacaatacttg
agaatagggtttgagtccgatgagacgacttggagagtcttccaattgagaaaagacttc
ttcccagctgccaaattgcagatggaagacgatatcaccgggtctgtcattgtcccaact
aagttgttgaagactccaatcaacactaatgggaagagagcgtgcaagatcgtcaagaat
tgtgaatatagactcttccaaagaccagacgatgccattttcagagggtatgataaacaa
actgaatatgacttctctattgaaggacacttcatctctaattaccaaccaatgactaga
gaagaggctgctgacttcaccaaggacgttgttagattgtaccaatacaccgaccctatg
agagtcactttgcaagactttgttgctggcaaagatcagacgaaatatgttgtgtcgtca
tcattaccaagacttgtgaaggaaggagacaagttggtctgctcgaagaacccaagatac
ttgcaaagaagaccagacatgttggacccagagaacacttatatgacattcaaagctatt
tcgttgttcagaaagatcgcagacactgatccattgtataccccagtcgatgctgtcttg
tctggaagaagaaacaacccaccacaaactaaaggagctcttgtcttaagaccactctcc
gtctttgctccactccactacttcgaattgccagagttgttgatggaagctatcacttcg
atgactggagcatcaccatctatcttcggtgcaggatctgaaggcgctttgactaaaggt
ccattcaactcccttccagctgttgttgatttgaacaactacttgttgggtatgatctgc
tgtggatactctggatttgtttcctcggcgtcgtattgtggcccacattataagatcagc
cacgacatctctttgttgatcccagaaatttggtccagaatgagaagaaacgaacaagaa
cctaaatacttgattgaacatggattcttggaagccgtcccagacgtctcttataacgga
aagacttacgcgggcagaagacttggatacagaatcactaaggagttcgctactcacttc
ttcagctcgatctttactgcaccaaactcagtgatgccagaagacttcttgaaaccagag
aagcaagacttggctatttatgctgattcatatgaatatatggcacagacagataaggga
attgctggtaattatatcgaagatggaactgtagaaggtgcttgcccaccattgaaggct
ttgttgtatatcatggctaatggaagttataacggcatgactatcgaatcaaaggaattc
agagacttgtttgatccaaaggccgtctttgctagtgaatggtacaaactcagattacag
acaagacaaaaagtcgaggagaagaagttgaacaaagacttgacttacttgaacaagatg
cttgctaatagaccaagaatcgctgataagatcaatgaacaaatcaaagaagtcaaggaa
gaactcgcttacatttcatccgaacaatacttgcaagacatcgacggttctatcggaact
gatccttacctctatacctgcaagaaacactaa

DBGET integrated database retrieval system