KEGG   Entamoeba invadens: EIN_129860
Entry
EIN_129860        CDS       T04133                                 

Definition
(RefSeq) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
eiv  Entamoeba invadens
Pathway
eiv00620  Pyruvate metabolism
eiv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EIN_129860
Enzymes [BR:eiv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     EIN_129860
SSDB
Other DBs
NCBI-GeneID: 14890569
NCBI-ProteinID: XP_004258377
UniProt: L7FNE3
LinkDB
Position
Unknown
AA seq 1154 aa
MFNQEKGTDYPVLNQANLEALADLKLSVMGHEFPQSTKNVEAIKVVEPLVDVLTEADQDV
TAPIDQRLQTFLNSYFAECKTEIPKIPDNTFILDQEGLGRVLSFPPHKDDFFCETMSSYK
IKQGVLHNPSKDKRTTVGVFHICEGDVPVPTDKIECPKSAFLRMLKAAFYEAPDSHLVIP
YTADCKAPTKSWVSLYMRPTVIPAVQGVKGFEHEKKTEIHFFVPGNMVSCLDFVESVFGN
AGNPKLLKNDAALDPLNWTGHTGMAVLAPHLTKITKKECGLPHISQATERQKKEHMCWEK
EDELYNDGKTFKMYARDANGVICTIIADNYFGYCKKEVKTQISFSANLYGLAEEEHAGGT
IARPSYDLGESCNAEKYAEGYKFEEMAEKNKNSLIMKEGYALDKQYPEGIIYVPGDSVFN
IEEASIKFHFNGKEQKILLVPKVNYVLPNGYIIILHDTMTSRRWTLRGILPQYTLCHKPC
TVSGGGKSEISKSIKDAVIEGGVFINNKAEDYAKVQEIFDHDYSKRFSNAPKNGDAAELK
ILDPKVTLGAVVELLTPSANFTEEHNTYVKNISPLIVELVMTIKSLYREDWKGDWQSRIT
VDKVNGQQGNELSYRKNKLSSQYLRVGFERDETTWRVFQLRKDFFPSAKLQMEDDITASV
IVPTKLLKTPINAVGKRACKIVKNCEVRLFQRPDDAVYRGFDKQTEHDFSIAGHFISNYQ
PMTREEAANFTKDVVRLYQYTEPMRVTLQDFVAGKDDVKYIVSSSHPRLVKEGDQLVHSK
NPRYLQRRPDMLDPETTYMTFKAIQLYRKLADTDPLYTPVDAVMSGRRNNPPQKKGNLVL
RPLSVFAPLHYFELPELLMEAITSMTGASPSIFGAGSEGALTKGPFNSLPAVVDLNNYLL
GMICCGYSGFVSSASYCGPHYKTDHDISLLVPEIWSKMRRYEQEPKYLIEHGFLEAVPDV
SYNGKTYAGRRLGYRITPAFADHFLRTLFSVPNSVMPEDMLKPEKQDLAIYADSYEYMSQ
TDKGIAGNYIEDGTVEGACPPLKALLYIMATGSYNGMTIESKEFRAMFEPENVFSSEWYK
LRLQTRQKTEVAKLNKNLKYLKDMIVARPRLTEKITEQIKEVNEELAYISSEQYLQDIDG
SIGTDPYLYTCKKH
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgttcaatcaagagaaaggtacagactacccagttttgaatcaggcaaacctcgaggct
ttagctgatttgaagctttcagtaatgggccacgagttcccacaatcgactaaaaacgtc
gaagcaataaaagttgttgagccattggttgacgtcctcactgaggccgaccaagatgtc
actgctcccatcgatcaacgacttcagacatttttgaactcatacttcgccgaatgcaag
actgagattccaaagatcccagacaacactttcattttggaccaagaaggtcttggaaga
gttttgtcattccccccacacaaagacgacttcttctgtgagaccatgtcctcatacaaa
atcaaacaaggtgtcttgcacaacccatcgaaggacaaaagaacaacagttggtgtcttc
cacatctgtgaaggtgatgtccccgttcccactgacaagattgaatgccccaaatccgct
ttcttaagaatgttgaaggctgcattctatgaagctccagatagccacttggtcatccca
tacactgctgactgcaaagccccaaccaaatcatgggtgtcactctatatgagaccaaca
gtcattccagctgttcaaggtgttaaaggttttgagcacgaaaagaagactgaaattcac
ttctttgttccaggcaacatggtttcctgcttggactttgtcgagtctgtctttggcaat
gctggtaaccccaagttgttgaagaacgatgccgcacttgacccattgaactggaccgga
cacactggtatggctgtccttgctccacacttgactaagatcactaagaaggaatgtggt
cttccacacatttcacaagctactgagagacaaaagaaggaacacatgtgctgggaaaaa
gaagacgaattgtacaacgacggaaagaccttcaagatgtatgccagagatgctaatgga
gtcatttgcactatcattgctgataactactttggctattgcaagaaggaagttaagacc
caaatctcattctcggcgaacttgtatggacttgccgaagaagaacacgccggtggaact
attgcgcgaccatcatatgatcttggtgagtcatgcaatgcagagaaatatgccgaggga
tacaaatttgaggagatggccgagaagaataagaactcgttgatcatgaaagaagggtat
gcccttgacaagcagtaccccgaaggtatcatttatgtcccaggcgattctgttttcaat
attgaagaggcgtctattaagttccatttcaacggaaaggagcaaaagatcttattagtc
ccaaaggtcaattatgtccttcctaatgggtatatcatcatcttacacgacactatgact
tcaagaagatggactttgagagggattttgccacaatacacactctgccataagccgtgc
actgtctctggtggaggaaagtctgagatttcaaagagcattaaagacgctgtgattgag
ggaggagtcttcatcaataacaaagcggaagactatgctaaagttcaagaaatattcgac
cacgactactcaaagagattttcaaatgctccaaagaacggggatgcggctgaattgaaa
atcctcgacccaaaagtcacactcggcgctgttgttgaattgttgacaccatcagctaac
ttcactgaagaacacaatacatatgtcaagaacatctcaccactgatcgtcgaattggtc
atgactattaagtcgttgtacagagaagactggaagggcgactggcaatcaagaatcacc
gtcgacaaggtcaacgggcaacaaggaaatgaattgtcgtacagaaagaataagttgtcc
tcacaataccttagagtagggtttgagagagatgagaccacttggagagtcttccagtta
agaaaggatttcttcccaagcgctaaattgcagatggaagatgatatcaccgcatcagtc
atcgtcccaactaagttgttgaagactccaattaacgcggttggcaaaagagcgtgcaag
atcgtgaagaactgcgaagttagactcttccaaagaccagatgacgccgtgtatagagga
tttgataaacaaactgaacacgacttctcgattgcgggtcacttcatttctaattaccaa
ccaatgacgagagaagaggctgctaatttcacaaaggacgttgttagattgtaccaatac
actgaaccaatgagagttactttacaagactttgttgctgggaaggatgatgtgaagtac
attgtctcctcgtcacacccaagacttgtgaaggaaggtgaccaattggtccattcgaag
aacccaagatacttgcagagaagaccagacatgttggacccagagactacttacatgaca
ttcaaggctattcaattgtacagaaagcttgcagacaccgatccattgtataccccagtc
gacgctgttatgtctggaagaagaaataacccaccacaaaagaagggcaatcttgtctta
agaccactctccgtctttgctccactccactacttcgaattaccagaattgttgatggaa
gctatcacttcgatgactggagcgtcaccatctatcttcggcgcgggatctgaaggcgct
ttgactaaaggtccattcaactcccttccagctgttgttgatttgaacaactacttgttg
gggatgatctgctgtggatactccggatttgtttcctcagcgtcatactgtggcccacat
tacaagactgaccacgatatctctttgttggtcccagaaatttggtctaagatgagaaga
tacgaacaagaaccaaagtacttgattgaacacgggttcttggaggccgtcccagacgtc
tcttataacggaaagacttacgcgggcagaagacttggatacagaattactccagcattt
gctgatcacttcttgagaacgttgttctctgttccaaattccgtcatgccagaagacatg
ttgaaaccagagaagcaagacttggctatctatgctgattcatatgaatacatgtcgcag
actgataagggtattgctggtaattatattgaagatggaactgtagaaggtgcttgccca
ccattgaaagctttgttgtacatcatggctacaggaagttataacggcatgacaattgaa
tcaaaggaattcagagctatgttcgaaccagagaacgtcttttcaagtgaatggtacaaa
ctcagattacagacgagacaaaagacagaggttgctaaacttaacaagaatttgaaatat
ttgaaggatatgatcgtcgctagaccaagactcactgaaaagattaccgaacaaatcaag
gaagtcaatgaagaattggcttacatttcatctgaacagtatttgcaggacatcgacgga
tcaattggaactgatccttacctctatacctgcaagaaacattaa

DBGET integrated database retrieval system