KEGG   Entamoeba invadens: EIN_145510Help
Entry
EIN_145510        CDS       T04133                                 

Definition
(RefSeq) heat shock protein 70kD, putative
Organism
eiv  Entamoeba invadens
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 14886618
NCBI-ProteinID: XP_004254358
UniProt: L7FKZ1
LinkDB All DBs
Position
Unknown
AA seq 265 aa AA seqDB search
MSTEQPKKTISIGIDFGTSKIVISYCDKNQQIRTVTFNDGSSITPAWLRLFYDTPNSPTM
SFVVGEQAKYPKDRLNYDNTFYNIKRLLGKTFEELQDESESLGFEFKEDNGHAVVVVNSQ
PEPTTFRPKEIAALFFKTLMNQIKMEVPDLVGPNMFVGVPVKMTAEAVQDLTDAAKLGGF
ETVDIITEPIATVLYYLDANKESAAKNFIIIDIGACTLTFHIFRKMQMDIMSRFTLIETT
TLVGTISMQLFMKLILIFMKKGPIL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgaacaaccgaaaaaaacgatttcaattggcattgatttcggcacatccaaa
attgtcatttcatattgtgataaaaaccagcaaattcgaactgtgactttcaacgatggc
tcatctatcactcctgcatggctacgacttttttatgacactcccaattcaccaacaatg
tctttcgttgttggcgaacaggctaaataccccaaagaccgactgaattacgacaacacc
ttttacaacattaagcgcttactaggtaaaacatttgaagagttgcaagacgagtcggag
agtttaggttttgagtttaaagaagataatgggcatgctgtagttgtagttaattctcag
ccagaaccaactactttccgacccaaagaaattgccgcccttttcttcaaaacactgatg
aaccaaattaaaatggaagtgcccgatcttgtaggacccaatatgtttgttggtgttccc
gttaaaatgactgcggaagctgttcaagatttgacagatgctgccaagttgggtggtttt
gaaactgttgatattatcactgagccaatagcaacagttctctattatttggatgcaaac
aaggaatcagcagcaaagaattttataataattgacattggtgcttgtaccctgacattt
catatattcagaaaaatgcagatggatattatgagtcggtttactctgatagaaacaacg
accttggtgggaacaatttcgatgcaattgttcatgaaattgatccttatttttatgaaa
aaaggcccaatactttga

DBGET integrated database retrieval system