KEGG   Entamoeba invadens: EIN_216610Help
Entry
EIN_216610        CDS       T04133                                 

Definition
(RefSeq) heat shock 70 kDa protein, putative
Organism
eiv  Entamoeba invadens
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 14891877
NCBI-ProteinID: XP_004259667
UniProt: A0A0A1UCD1
LinkDB All DBs
Position
Unknown
AA seq 270 aa AA seqDB search
MAKEIIYVGIDLGTTYTKAAYYSSVSQCVKTLTFSSNEQSVRSTVDFNSYPVKVATESIT
SIKEVKRILGVAFKDDSIVNIKSNYADILEDIDGFCYFNTTFQGRPTPVRPVEISAIILS
HVKKQVIENVDFDPQRQSMKVVVTHPVFFDQKQRDLTEEAAKIADLDVIGLISEPTAAAY
NYSLNNLPNGMIFFFDFGGGTLDTAVGEKKGSHIKFCGIHGDKNLGGIDIDIALLDYVMN
EWKEYNENEVNNLFKVQNGDSTTIQKKKVY
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaattatatatgttggtattgatcttggcacaacatataccaaagctgct
tattattccagtgtgtctcaatgtgtcaaaactttgaccttttcgtccaacgaacaatcc
gttcgttcaactgttgatttcaatagttatccagttaaagtagcaaccgaatcaattact
agcataaaagaagttaaacgtattttaggtgttgcttttaaagatgattcaattgttaac
atcaaatcaaattacgcagacattttagaagacattgatggattttgttattttaataca
actttccaaggtcgcccaacaccagtccgccccgttgaaatttctgcaatcatattaagt
cacgtcaaaaagcaagttattgaaaatgtggatttcgaccctcaaagacagtcgatgaaa
gttgttgtgacacaccccgtcttttttgatcaaaaacaaagggacttaaccgaagaagca
gcaaaaatagcagaccttgatgtcattggattaatatcagaacccacagcagctgcatat
aattattctttaaacaatttaccaaacggaatgatctttttctttgactttggaggagga
actttagacactgctgttggcgagaaaaaaggcagtcatattaaattctgtggtattcat
ggcgataaaaaccttggtggtattgacatcgatattgcacttctggattatgtcatgaat
gagtggaaggaatacaatgaaaatgaggtaaacaacttatttaaagtgcaaaatggtgat
agcacaacaatacaaaagaaaaaagtatattga

DBGET integrated database retrieval system