KEGG   Entamoeba invadens: EIN_284940Help
Entry
EIN_284940        CDS       T04133                                 

Definition
(RefSeq) set and mynd domain containing protein, putative
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
eiv  Entamoeba invadens
Pathway
eiv00310  Lysine degradation
eiv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    EIN_284940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eiv03036]
    EIN_284940
Enzymes [BR:eiv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     EIN_284940
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     EIN_284940
Chromosome and associated proteins [BR:eiv03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     EIN_284940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF4993
Motif
Other DBs
NCBI-GeneID: 14883892
NCBI-ProteinID: XP_004184254
UniProt: L7FM16
LinkDB All DBs
Position
Unknown
AA seq 439 aa AA seqDB search
MAGEYPSPGDMVDKRYDVRVPSRTEKIDRSSLPLFTSYDELFAAEFPKRKFAVEELEGKG
RGIVATWSIKKGEMVMRERASTVFFGEEPEDPNIDSTYFLIKNLYEGNATITPSFATELG
QNPSRISEFEEHVQFMLNDFKEKGKGFKYEVKEDELRKIVNGIHTNSFSFDFQDGFAVFM
GCSLVNHSCQENMGWHTVGDEMIFTALEDIEQGTELTISYSFPNLNAKRMKYYEDNYGFV
CDCKLCEGGIDSWRVFECTHCGGKIYPDVNGWSCHSCSKICTKEEIYFFEAEEKSILEFK
FESRFRWLYRPMRKMSPYHLVLFKALRNYFMTNACPNPVQLAENILIPVAEFHRDLSHGR
LYAAVMEQYAMVLLKYALLMTDNEDWCKRKALECLRKAYDYRCEIGMGITGYAAAIYLEY
LGFFEGDKIKGDIVHYEEY
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgagtacccatcgcccggggacatggtcgacaaacggtatgatgttcgtgta
ccgagtcgcactgagaaaattgatcggtctagtctcccccttttcacatcatacgacgag
ttgtttgcagccgaatttccaaaacggaagtttgcagtcgaggagttagaaggaaaggga
cgtgggatagttgccacgtggtcaatcaaaaaaggggagatggtaatgcgtgagcgcgcg
tcgacagtattctttggtgaagagccagaggatcccaacattgattccacctattttctg
atcaaaaacttgtatgaaggaaatgcgaccattacgccatcatttgctactgaattggga
cagaaccccagtcggatttctgaatttgaagaacacgtccagttcatgttaaatgatttt
aaagagaaaggaaaggggttcaaatatgaagttaaagaagacgagctgagaaagatagtg
aatggcattcatacgaattcattttcatttgattttcaagacggatttgcggtgtttatg
gggtgcagtttggtgaatcactcatgccaagaaaacatggggtggcatactgttggcgat
gagatgatatttactgctcttgaagatatcgaacaaggtacggaattgacgatttcatat
tcatttccaaatttgaatgcgaagagaatgaagtactatgaagataactatgggtttgtg
tgcgactgtaaattgtgtgaggggggaatagactcgtggagggtctttgaatgcacacat
tgtggcggaaagatatatccagacgtgaatgggtggtcgtgccattcatgctcgaaaata
tgtacaaaagaagagatctatttcttcgaagcagaggagaagtctattttagaatttaag
tttgaaagtcggttcaggtggttatacagaccaatgagaaagatgagcccctaccatttg
gtcttatttaaagctctcagaaattatttcatgactaacgcgtgtccaaatccagttcaa
ctcgcagagaatattttgataccagtcgcagaattccacagagacttgtcacatggaaga
ctgtacgctgctgtcatggagcaatacgcgatggtgttgttgaagtacgcattgttgatg
acagataacgaggattggtgcaaaagaaaggcacttgaatgcctcagaaaagcgtatgat
tataggtgcgaaattgggatgggcataactggatacgccgctgccatttatttggaatat
ctgggctttttcgagggggataagatcaagggggacatcgttcattatgaggaatattaa

DBGET integrated database retrieval system