KEGG   Entamoeba invadens: EIN_306430Help
Entry
EIN_306430        CDS       T04133                                 

Definition
(RefSeq) hypothetical protein
  KO
K19720  collagen, type III, alpha
Organism
eiv  Entamoeba invadens
Pathway
eiv04933  AGE-RAGE signaling pathway in diabetic complications
eiv05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    EIN_306430
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    EIN_306430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:eiv00536]
    EIN_306430
Glycosaminoglycan binding proteins [BR:eiv00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   EIN_306430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2
Motif
Other DBs
NCBI-GeneID: 14885700
NCBI-ProteinID: XP_004186063
UniProt: A0A0A1TYU3
LinkDB All DBs
Position
Unknown
AA seq 680 aa AA seqDB search
MAPFGFFKKKSSSHASGGSAPPPPGDLAPPPGLAPPPGMMPPPPGPPPPSNSKMPAPSSA
GRGDLLSQIQKGKKLQKCETVDKSAPMIEGKKGSGGMGGGMGGMGGNPMAAAIASRANRG
GGAHAPPSRGGMQRSAPPPSRAMPPRGGAPRGGRGGRGGMPPPQQYEEPQEEQQEEEQPQ
QFQMPPRGAPRGAPRGAPRGAPAPRGAPRGGRGGMPPPQPQYEEPQEEEEQPQQFQMPSR
GAPRGAPAPRGTSRGAPAPRSAPRGAPRGGMSSSAQPPPPPMGMMPPPPPNMPPPPSGGD
APSAPPSSAGRGDLLSQIQAGRKLKKAVTVDKSAPAISNKPSGGMGGGMGGGMGGMGGNP
LAAAIAARANRAGGAHAPPSRGGMQRSAPPPAAQPPMHRGAPAPRGAPRGGRGGMPPPQQ
REEPQEEQQEEEQPQQFQMPSRGAPRAAPRGAPAPRAAPRSAPRSASRGAPRGGMSSSAQ
PPPPPMGMMPPPPPNMPPPPSGGDAPSAPPSSAGRGDLLSQIQAGRKLKKAVTVDKSAPA
ISNKPSGGMGGGMGGGMGGMGGNPLAAAIAARANRAGGAHAPPSRGGMSQSAPRPAAQPP
MHRGAPAPRGAPRGAPRGGRGGMPPPQQYEEPQEEQQEEEQPQQFQMPPRGAPRGAPRGA
PRGAPAPRGAPRGGRGGRGM
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggctcctttcggattctttaagaagaaatcctcatcacacgcctctggaggttcggca
ccaccacctccaggagacttggcaccaccaccaggactcgcgccaccaccaggaatgatg
ccaccaccaccgggaccaccaccaccttctaactctaagatgcctgctccatcgtctgct
ggaagaggcgacttactctcgcaaattcaaaaaggaaagaaactccagaaatgtgaaaca
gttgacaagtctgccccaatgatcgaaggtaaaaaaggatctggaggaatgggaggagga
atgggcggtatgggtggaaacccaatggccgctgctatagcttcaagagcaaatagaggc
ggaggagcacatgcaccaccatcaagaggagggatgcaaagatcagctccaccaccatca
cgcgctatgccaccaagaggaggagctcctcgcggcgggaggggtggaagaggcggaatg
ccaccaccacagcaatacgaagaaccacaagaagaacaacaggaagaggaacagccacaa
caattccaaatgccgccaagaggcgcaccacgtggagctccaagaggcgcccctagaggt
gcaccagcacccagaggcgccccaaggggaggaagaggcggaatgccaccaccacaacca
caatatgaagaaccacaagaagaagaagaacaaccacagcaattccaaatgccatctaga
ggtgcaccacgtggagcaccagcaccaagaggaacttctagaggtgcaccagcaccaagg
tcggcaccccgaggtgcaccaagaggaggtatgtcttcatcagcacaacccccaccacca
ccaatgggtatgatgccgccaccaccacctaatatgccaccaccaccatctggtggagat
gcaccatcagcaccaccatcgtctgctggaagaggcgatttactttcacaaattcaagca
ggaagaaaactcaaaaaagcagtaaccgttgataaatcagcgccagcaatcagcaacaaa
ccgtcaggaggtatgggcggtggaatgggaggaggaatgggcggtatgggcggaaaccca
cttgccgctgccatcgccgcacgagcaaacagagccggaggagcacatgcaccaccatca
agaggaggtatgcaaagatcagctccaccacccgctgctcaaccaccaatgcacagaggt
gcaccagcacccagaggcgctccaagaggaggacgtggaggaatgccaccaccacaacaa
cgtgaagaaccacaagaagaacaacaggaagaggaacagccacaacaattccaaatgcca
tctagaggcgcaccaagagctgcaccacgtggagcaccagcaccacgagccgctccacgt
tccgcaccaaggtcggcatcccgaggtgcaccaagaggaggtatgtcttcatcagcacaa
cccccaccaccaccaatgggtatgatgccgccaccaccacctaatatgccaccaccacca
tctggtggagatgcaccatcagcaccaccatcgtctgctggaagaggcgatttactttca
caaattcaagcaggaagaaaactcaaaaaagcagtaaccgttgataaatcagcgccagca
atcagcaacaaaccgtcaggaggtatgggcggtggaatgggaggaggaatgggcggtatg
ggcggaaacccacttgccgctgctatagctgcacgagcaaatagagccggaggagcacat
gcaccaccatcaagaggagggatgtcccaatctgctccgagaccagctgctcaaccacca
atgcacagaggtgcaccagcaccacgcggagctccaagaggagcccctagaggcggaaga
ggcggaatgccaccaccacagcaatacgaagaaccacaagaagaacaacaggaagaggaa
cagccacaacaattccaaatgccgccaagaggcgcaccacgtggagctccaagaggcgcc
cctagaggtgcaccagcacccagaggcgccccaaggggaggaagaggcggaagaggaatg
taa

DBGET integrated database retrieval system