KEGG   Entamoeba invadens: EIN_360860Help
Entry
EIN_360860        CDS       T04133                                 

Definition
(RefSeq) hypothetical protein
Organism
eiv  Entamoeba invadens
SSDB OrthologParalogGFIT
Motif
Pfam: TLD AKNA EF1_GNE STN1_2
Motif
Other DBs
NCBI-GeneID: 14889849
NCBI-ProteinID: XP_004257684
UniProt: A0A0A1U7P9
LinkDB All DBs
Position
Unknown
AA seq 318 aa AA seqDB search
MQNQFATLSTLYDKVRDEYTTFNNMKIETIFVDNKSLSLAQRLTNTEKFLDQIEEKFLRR
QTIIQSYNNILEKLDELTKQLKSNYNEVSKQSEIEKAYEVFNLQILLIEEQYKNKIEPFE
EQIQIINNEKASIIDEIRKSKMYSMYLKTTEPPVIITQGEKESLEILLNQKITNVLFDST
IDDWSLNSSVFSERVLNKSNLCVLIEDTNHNKFGGVFNGEISDIGHYHNGGESFLFSLVR
NGTLNPKKFRKSNNYSFYEMCCYEQNSKVLFSFGFYDDICVYKKGIDKNFCKPCTFTAKQ
NELTDNDKFVTKSIIINY
NT seq 956 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaatttgcaacactttcaacactttatgacaaagtacgcgatgaatacact
acgtttaacaacatgaaaattgaaacaatttttgttgacaacaaatcactctcacttgct
caaagactaactaataccgaaaagttcctggatcaaattgaagaaaaatttttaagaaga
caaaccattattcagtcttacaacaatattttagaaaaacttgacgaattaacaaaacaa
ctaaaaagtaactataatgaagtttcgaagcaatctgaaatagaaaaagcttatgaagtt
ttcaacctacaaatattattgattgaagaacaatacaaaaataaaattgaaccatttgaa
gaacaaatccaaataataaacaatgaaaaggcgtccataatagatgaaataagaaagagt
aaaatgtatagtatgtatttaaaaacaacagaaccacctgttattattactcagggagaa
aaagagagtcttgaaattttattaaaccaaaaaataacaaatgttttattcgatagtaca
attgatgactggtcactgaacagttcagtgtttagtgaaagagttctgaacaaaagcaac
ttgtgcgttttgatagaagacacaaatcacaacaagtttggtggcgtgtttaatggtgaa
atttctgatattggccattatcataacggtggagaatcattccttttttcacttgtgaga
aatggcactttaaatccgaaaaagtttagaaaaagtaacaattattcgttttatgaaatg
tgttgttatgaacagaatagtaaagtactcttttcgtttggcttttatgacgatatatgt
gtgtacaagaaaggcattgacaagaatttttgtaaaccttgcacgttcactgccaaacaa
aatgagttgactgataatgataaatttgtaacaaaaagtattattataaattattg

DBGET integrated database retrieval system