KEGG   Entamoeba invadens: EIN_378040Help
Entry
EIN_378040        CDS       T04133                                 

Definition
(RefSeq) midasin, putative
  KO
K14572  midasin
Organism
eiv  Entamoeba invadens
Pathway
eiv03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    EIN_378040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eiv03009]
    EIN_378040
Ribosome biogenesis [BR:eiv03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    EIN_378040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_5 AAA_lid_5 AAA_3 AAA_lid_7 AAA_7 AAA AAA_16 AAA_6 AAA_22 Dynein_heavy AAA_18 TsaE ABC_tran Sigma54_activat AAA_30 RsgA_GTPase AAA_33 RNA_helicase T2SSE AAA_14 PduV-EutP Mg_chelatase Sigma54_activ_2 NACHT AAA_25 RuvB_N AAA_28 AAA_29 AAA_19 SRP54 KAP_NTPase CbiA DEAD ResIII ATPase
Motif
Other DBs
NCBI-GeneID: 14882434
NCBI-ProteinID: XP_004182865
UniProt: A0A0A1TUA4
LinkDB All DBs
Position
Unknown
AA seq 3416 aa AA seqDB search
MKTLKNTMKPNYVPTPFARTQAVVETLLKDGTPVLLEGKSGCGKTSLLKHISEQQHSKML
SVHFGDDIDSKALIGSYITSDSFSEFKWKDGSLTTAVKEGLWFLLEDVDTAPGDVISLIT
SLLKTRTFFIPNRNETVTVHSNFRILATRTLHKGGMRVNQFHNALSSYFSLVAMPDIKID
DLESLLNTMFGRVSVLIPTMIKVHFTLETLGVEVSLRQLLSLCQRVQEQIPVETKINIAT
TQMKHIILFECDNVYLSNTLDKRVGVLEKVARTIEIPSITFMLDGYKPELTTTRDTLQIG
HVILKKNPPIIPPPPQSPFPFSQTQHSLCLLEKLADCVKNEEPVLLVGETGTGKTTMVQQ
LATLLNQKLVVYNLNQQTESSDLVGGFKPVQMKLLCHPLRIEFIEKFNQIFAQSNNEKFL
LQLDAAYEKQDFGRFLTLVLKACEMAASKISQLETTERENWRKIENKARKYKEQITNKQG
GFAFSFIEGDLITALRNGHWILLDEINLASHETLERISGLLDGESILLTEVGDVTPVPRN
PNFRLFANMNPPTDVGKKDLSPGIKSRFHPIQFDEIIKENDLEMLVNDYLKRIGVTPPSK
KIVEFHLQAKKLAKEELVDGAGQRPLFSLRTLCLALQYITDVNGFFGFERSLYEGISMSY
LTQLSRESYPIMENMINSMFTKSNNSGSIPKNKSYVQYGGYFIEQGLEVPRLDEKYILTE
TTQKRLESIARIVMSKRYPILLQGPTSAGKTSLVEYLAHATGHRMVRVNNHEQTDVQEYL
GSYVPTEDGKLVFQEGILVEAVRKGYWIVLDELNLAPSEVLEALNRLLDFNRELYIPETQ
EVVKPHPQFMLFATQNPPNTYGGRKHLSRAFRNRFIELHFDEIPENELEIIIEKRSQIPP
SYSKKLVQVLKDLQKQRSMTQFFGGKHSFITLRELFKWADRHASSYEELARDGYFIVAEK
MRTQEEKNVIQKVIEDDLKVKIDFTTVYECKEFVEASKLCPEIVWTPSMKRLFCLIVECV
KNKEPALLIGETGTGKTTVCQILAKVLNNRLRILNCHQHTETADFIGGMRPARNKDQTTF
KLHKALETLLKTTGTLQELLIIYQKNYKSYQKNEVEDIESLLKEYKILFKWYDGPLIEAM
KTGEMFLIDEINMAEDSVLERINSVLEPSRMMTIAEKTSTEIEEVVANDTFRIFGTMNPG
GDFGKRELSPAMRNRFTEIYVKSFEAEGDLLLIVQQKINEPTEKKFAAAIVKFLMWAEKK
FGKKVSVRNCLAWTDFMNCCTSIPSPLVRFIHAAHLVVIDGVKDEVGKTNAECLIALNEA
LVTIGEKLEDSIVQEMSMQPTLSVGPTNISVSDFTITANGPIQKQDNYCVEAPTTTNNIL
HLLRALVLHKSILMEGSPGVGKTTIIEILSSMLNIPLFRINLSEHTDISDLLGTDLPLEG
SSGGFGWCDGLLLRAMKSGSWVLLDELNLASQSVLEGLNSLLDHRATVYIPEINMEVKCP
PTFRLFASQNPLGEGSGRKGLPQSFINRFTSVYVNKMTESDLKLIVEKMYPMIPVELRES
LIDFVGQLENQVCCKKNFGRRGEPWEFNLRDVLRYCKLYSEYSQRIDTDTMKGNMDTLGF
IFTEIFKGRFRDVVDIQKVEELWRSCLSPKYKEMSMEYHNDIHITPERFIIGEVEVSRTV
NRDTTNSDKYILPTHVESMKQVMKGINHNWLISLIGDSHCGKATLVRNVAQLCGSVLKEF
SMNTSVDTIDLIGGYEQLDFERHRRSFLEDLRDYMKLVTNKEALSIYSTLERCTKVSEID
RKHDCIFSSTEMNIIKGLIKVLNDEYFQSEITRIEVTQQKKSIGSFEWVDGIVVKCMKRG
YWLLMENVNFCNPTVLDRLNSLFEPNGYLVLNERGVDSNGIPIIVKPHNNFRVIFTSNPM
NGEISRAMRNRALELYVPQIREIDAQRMLTGFGVSLQTAKKMIAIHLKTENMTFLHLMRW
AKYVGKNGESAMKEGFDIFYVQTKSDLNEQEKLRNIYLNQQDIECNEYESVVFKLFAQAT
ICNLNVFEENVSIGNLMNQMSQIIPLICDQVPQNAMEVDYFSLKNVIVNTLKDVKFESTM
KYKEYISMVLYLLDDIDRVNYLSLLQSIEGGENIIVYIQNENLIRQHSSRQIRGMYALYL
LMKREEEKVRVEENGKSILSKSYRKIGNVYSKYLVIEQNYNEFLELLDKTICELHTLDEQ
TQYYVLSLRVLFGVVGMNENLQLERYIILCVMLRSLHPTYQTLTNDLFARFNIDESFIGS
LWSGFSSSLYPKQPTRLSEVLKICGERYGKNDVKILSTLIQKSYTDEEFELTKPQIEKET
MLTPLYDFLVNLQVVSQVLNGVECTANPLVHFFQTVSKENSIYTIPMIMKALDSLWKNHP
DLPFLPKSKQLKGVSLLYQSVIPRARAHFTSKEVLDVLPISMQFNLLKDIKNISFSSTND
VTDIINKLLNIVHNTLTEMFASIVQQKCDMSVSLNLISRKLNGLYNETIQTVCGNSEKEE
SANLFKYGSFMYQAFSIPCIDPMEFPKHFISVSNERIEIISNQIESVINLQSHVFGKGFE
RILNFLEMSRNTVRSGMKKYEEFNKERITEQKFENLYQEFVLFSSSNGDYLKIKRLYDDI
ENVNEVAQLIRIITQETMWQEQTEFFIEHIQKDYPLFLDLTIPVLFGLYLLKTGLRIGLY
KKIVLYLRNEKTELLLKSVITFPVNSNMIQEQAKCIGDFIIQHIEENKNVQNSELIKIVL
VNVIREMWGDKAGAMKVISLLLHLMTTLKNAEDEEKRKIIEEEQVTYKYTTKTNQLAVDE
DKEEEEYRAEFPDFFADVQDLLKTQSLSMEIETKTNENKKKKARVWMSDSDIQFIMKLIS
KLLKAQKCQESFEEMYETRNKIFKEILDEFFDTRDLPLPKEFDCISSPFHNIFIDKKVAI
LSQTKAERTIDLNKDGSVYEVNELLKKLEPLCTHVLKLLEEFPENEMLVKILSIIERLKN
FPKTDPLMRYLIVLHILFGELQNWETVAAKYVSLREEMNVVATIIQKWRCWQLKSWDKMT
ESLNEDQLIQARAWFVNVWKMVDEMVNNEVDEQIELGFLESMNQFMYKCTYGQFEERLKV
LGIVIQICECSENRNARFGKVKVMLTQIREYYNVFVSRIKEDIDRETKPVETKIKEFVKL
IRWNDINHEKIKDQVEKSNRKLNGFKREYDDILKKNVQFVVQSQTFANTTSATDKALGPI
FKEIHKSEKIKKTVDSKKRTDNIGYFINKIAVLEENTIRVCVEEKMSKEKSGVVWLEEVE
KELIGRVVELQNLTGKEGVKTKKRALLDALELFEVLKLPHSRKSVKVEEVVLESVLRRNY
KLEGEDDVIKNVNEYHYRTLSKLELFNKTKVTPSSDLNAKEIEYMQGFVYNLYSMC
NT seq 10249 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgaaaaatacaatgaagccaaactacgtaccaacaccatttgcaagaaca
caggctgttgttgagacgcttcttaaagatggtactcctgttcttctcgaaggcaagtcg
ggatgcgggaaaacttctctgttgaagcatatttcagaacaacaacacagcaaaatgttg
tctgtgcactttggtgacgacattgactcgaaggcacttatcgggtcttacatcacaagt
gattctttcagtgaatttaaatggaaagatggctctctcacaaccgccgtaaaagagggt
ttatggttcttattagaagacgtcgacactgcacctggcgatgtcatttccttaatcact
tcgttacttaaaacgcgaacctttttcattccaaatcgcaacgaaaccgtcactgtccac
tccaacttccgaatattagcaacacgaacattacataaaggaggaatgcgagtcaatcaa
ttccacaacgcactgtcttcctatttctctttagttgctatgcctgacatcaaaatagac
gatttggagagtttactgaataccatgtttgggagagtgagtgtgttaattccaactatg
attaaagtccacttcactcttgaaacccttggcgtcgaagtatcattgagacagttactc
tcactctgccaaagagttcaagaacagattccagtcgagacaaagatcaacatagctaca
acacaaatgaaacatatcatccttttcgaatgcgacaacgtctatctttcaaacacattg
gacaaaagagtcggcgtcttagaaaaagttgctcgaacaatcgaaataccatcaatcact
ttcatgctcgatgggtataaaccagaacttacgacaacaagagatacattacaaatagga
cacgtcatcttgaagaagaacccccctatcatcccgccacccccacaaagccctttccca
ttttcacagacacaacactctctctgcttattggagaagttggcggactgcgtgaagaac
gaagaacccgtccttttagttggagagactggtacagggaagactactatggtgcaacaa
ttggcgactttattgaatcaaaaactcgtggtatataacttgaatcaacagactgagtcg
agtgacttggttggtgggtttaaaccagtgcaaatgaagttattgtgtcatccccttcga
attgaattcattgaaaagttcaatcaaatatttgctcaaagtaacaatgagaagttttta
ttacaacttgatgcggcgtacgagaaacaagactttggcagatttctcacgttggtctta
aaagcatgtgaaatggcagcatctaaaatttctcaattggaaactactgaacgagagaat
tggcggaagattgagaacaaagcgcggaagtacaaagagcagatcacaaacaaacaagga
gggtttgcattcagttttattgaaggtgatttgatcactgcattgaggaatggtcactgg
atcttacttgatgaaatcaacttggcgtcacacgagacactggaaagaatatctggactg
ttggacggagagtcgatcttattgactgaagtgggagatgtcaccccagtgccacgaaac
cctaattttagactctttgcgaatatgaaccctccaacagatgttgggaaaaaagacttg
tcgccgggaatcaagtcccgattccatccaattcagtttgacgaaattattaaagaaaat
gacttggagatgcttgtgaatgactatttgaaacgaattggtgtcacccctccatcgaag
aagattgtcgagttccacttgcaagcaaagaaattggcgaaagaagaattagttgatgga
gccggacaacgcccactgttttcgttgagaaccctttgtcttgctttacaatatatcacc
gatgtcaatgggttctttggatttgaaaggagtttgtacgaaggtatttcgatgtcttat
ttgactcaactgagcagagaaagttaccccataatggagaatatgatcaattcgatgttt
actaaatcgaataacagtgggtctattcctaagaacaaaagttatgtccaatatggcggg
tatttcattgaacagggtttggaggtaccaagacttgatgagaagtacattttgacagaa
acgacacagaagagacttgaaagtatcgcgagaattgtcatgtcgaagcgataccctatt
ttactccaaggaccaacttctgctggtaaaacttcattagtcgaatatttagctcacgcg
acggggcatagaatggtcagagtgaataaccatgaacaaacagacgttcaagaatacctt
gggagttatgtcccaacagaagacgggaaattggtgttccaagaagggatattggttgaa
gcagtgagaaagggatattggattgtacttgatgaacttaacttggcaccttcagaggtg
ttggaagcactgaatagacttttggacttcaacagagaactgtatattcctgagacgcaa
gaggtggtcaagccccatccacagttcatgttgtttgcgacgcaaaaccccccaaatacg
tatggaggaagaaaacatttgtcacgtgcgtttagaaatcgatttattgaattacacttt
gacgaaatacctgaaaatgaactggaaattattattgaaaaaagaagtcagattccacca
agttattcaaagaagttggtccaagtgcttaaggaccttcagaagcaacgctcaatgaca
cagttctttggaggaaaacattcgtttattacactcagagagttgtttaaatgggctgac
agacatgcgagtagctatgaggaattggcgagagatgggtactttatagtagccgagaag
atgagaacacaagaagaaaagaatgtcattcagaaggttattgaagatgatctgaaggtg
aaaatagactttaccactgtgtatgaatgtaaagagtttgttgaagcatcgaagctgtgt
ccggaaatcgtgtggactccttcaatgaaacgactcttctgcttaattgttgaatgcgtc
aaaaataaagagcccgcacttcttattggagagacgggtacggggaagacaacggtgtgc
caaattttggccaaagtattgaacaacagactgagaatattgaactgccaccaacacacg
gaaactgctgatttcattggaggtatgcgaccagctcgaaataaagaccaaacgactttt
aagttacacaaagcgttggagacgttgttaaagacgacaggaacgttacaagagttgtta
attatttatcaaaagaattataagagttaccaaaagaatgaagtggaagacatagagagt
ttattgaaagagtataaaatattatttaagtggtatgatggacctttaatagaagcaatg
aagacgggggagatgtttttgattgatgaaattaatatggcggaggattctgttttggaa
agaatcaattcagtgttagaaccttcaagaatgatgaccattgcagagaagacgtcaaca
gagatagaagaagttgttgcgaatgatacttttagaatctttggaacaatgaatcccggt
ggagactttggtaaaagagagctgagtcctgctatgagaaaccgatttacagaaatctat
gtcaagtcgtttgaagcagaaggagacttgttactgattgtccaacagaagatcaatgaa
ccaacagagaagaagtttgcggctgctatagtcaagttcttgatgtgggcggagaagaaa
tttgggaagaaagtgtcagtcagaaattgcctagcgtggactgattttatgaattgttgt
acgagtataccatcacctcttgttcgattcatccatgcagctcatttagtagtgattgat
ggtgttaaggatgaagtagggaaaacaaatgcggagtgtttgatagcattgaatgaggca
ttggtgactattggagagaaattggaagactctatagttcaagagatgtcgatgcaacca
actttgagtgttggaccaaccaacatcagtgtatcagacttcactatcacagcaaatggt
ccaattcaaaaacaagacaattactgcgtggaggcgccaactactactaacaacatactt
catttattgagagcgttggtactccataaatcgatattaatggaaggatctcctggagtt
ggaaagacgacgataatagagatattatcatcaatgttaaacattccattgtttagaatc
aatctgtctgaacacacggacattagcgatttacttggaacggatctcccacttgaagga
agcagtggaggatttggatggtgtgatggattgttactgagagcgatgaaaagtggatca
tgggtgttactcgatgaactcaacttggcttcacaaagtgtattggaaggtcttaattcg
ttgttggatcaccgagcaactgtatatataccagagatcaatatggaagtgaaatgtcca
ccgacatttagactgtttgcaagtcagaatccacttggagaagggagtggaagaaaggga
ttgccacaatcgtttataaaccgatttacatcagtgtatgtcaataagatgactgaaagt
gatttgaaattgattgtcgagaaaatgtatccaatgattccagtcgaactgagagagagt
cttatagactttgtggggcaacttgagaatcaagtgtgctgtaaaaagaattttgggaga
cgtggagagccgtgggaattcaatttaagagatgttttgagatactgtaaattgtattct
gaatattcacaacgtattgatactgatacaatgaaaggaaatatggacacacttgggttt
atattcactgaaatctttaagggaagatttagagatgttgttgatatacaaaaagtcgaa
gagctctggagaagttgcttgtcaccaaaatacaaagagatgtcgatggaatatcacaat
gatattcacattactccggagagatttattattggagaagtggaggtgtcgagaactgtt
aatagagatacaacaaactcagacaaatatatattaccaacacatgttgaatcgatgaaa
caagtcatgaagggtattaatcataactggctcatatcacttattggagactcacattgt
ggaaaggcgacgttagtgaggaatgttgctcaactatgtggaagtgttttaaaagagttt
tcgatgaacacaagtgttgacacgatagatctcattggtggatatgaacaactcgatttt
gaaagacacagaagatcatttttggaagaccttcgagattacatgaaattggttacaaac
aaggaagcgttatcaatctattcgacattggagaggtgtactaaagtgtctgaaattgat
aggaaacatgattgtatcttctcatcaactgaaatgaatatcattaaagggttaattaaa
gtacttaacgatgaatatttccagtctgaaataacacgaatagaagtgacacaacagaag
aagtcgattggttcatttgaatgggtggatggtattgtagtgaagtgtatgaaacgtggg
tactggttgttaatggaaaatgtcaatttctgtaacccgactgtacttgacagacttaat
tcactctttgaaccaaatgggtacttagtgttaaatgaacgcggtgttgatagtaatggc
attccaatcatcgtgaagccccacaacaactttagagtcatctttacatcaaatccaatg
aatggagaaatatcacgagctatgaggaatagagcgcttgagttgtatgtaccccaaatt
cgtgagatagacgcacaacgcatgttaactggatttggagtgtctttacaaacagcgaaa
aagatgatagcaatacatctaaagacggagaatatgacgtttttgcatttgatgagatgg
gcaaagtatgtcgggaagaatggagagagtgcgatgaaagagggatttgacatcttctac
gtccaaactaaatcggatttaaatgaacaagagaagttaagaaacatttacttgaatcaa
caagatattgaatgtaatgaatatgagagtgttgtattcaaattgtttgcacaagccaca
atatgcaatttgaatgtgtttgaggagaatgtgtcgattggaaatttgatgaatcaaatg
tcacaaatcatcccattaatatgtgatcaagtgccacaaaatgcaatggaagttgactat
ttttcattgaagaatgtcattgttaacacgctgaaagatgtcaaatttgaatcgacgatg
aagtacaaagaatacatttcaatggtgttgtatttacttgatgatattgatcgagtcaat
tacttgagtttgttgcaaagcattgaaggtggagagaacatcattgtgtatattcaaaac
gagaacttaataagacaacattcaagtcgacaaattcgagggatgtatgcactctatttg
ttaatgaaacgtgaagaagaaaaggtgcgagttgaagagaatggcaaaagtattctctcg
aagtcatacagaaagattgggaacgtctattcgaagtatttggtcattgaacagaactat
aacgaatttttggaattacttgataaaacaatttgtgagttacacactttggacgaacaa
acacaatattacgttctttcacttcgagtactttttggtgttgtgggaatgaatgaaaat
ttacaattagaacgatatattatcttatgtgtgatgcttagaagtttacatccgacatat
caaacacttacaaacgacttgtttgcccgtttcaatattgatgaatctttcattggatct
ttatggtctgggttttcaagttcgttatatcccaaacaacccactcggttatctgaagta
cttaaaatatgcggagaaaggtatggaaagaatgatgtcaagatattatcaacgttaata
cagaagagttatacagatgaagaatttgagttgacgaagccacaaatagaaaaggaaaca
atgttgacaccactgtacgactttttagtgaatcttcaagttgtatcacaagtcttaaat
ggagtagagtgcactgcaaatcctttggtccacttcttccagactgtttcaaaggagaat
tctatatatacaattccaatgataatgaaggcacttgactcgttgtggaagaaccaccct
gatttgccattcttaccaaagtcaaagcaattaaaaggcgtgtctttgctctaccaaagt
gttatacctagagcacgagcacattttacatcaaaagaagtgttggatgtcttaccaatt
tcgatgcaatttaacttgcttaaagatattaagaacatctcattctcttcaacaaatgat
gtcactgatatcattaataaattactaaatatcgttcacaacacattgactgagatgttt
gcatcaattgtacaacaaaagtgtgatatgtctgtctctttgaatttgatcagtcgtaaa
cttaatggactttacaacgagactattcaaacggtttgtggaaactcagagaaagaggag
agtgcaaatttgtttaaatatggtagtttcatgtaccaagcattttctattccatgcatc
gacccaatggagttcccaaaacatttcatttctgtttcaaatgaacgtattgaaataatt
agtaatcagatcgaaagtgtcattaatttacagagtcatgtatttggaaaagggtttgag
cggatactaaactttttggaaatgtcgagaaatactgttcgaagtggaatgaagaagtac
gaagaattcaacaaggaaagaattacagaacaaaagtttgagaacttgtatcaggaattt
gtattgttttcatcatcgaatggagactacttgaagatcaaaagactgtatgatgatatt
gaaaatgtcaatgaagttgctcaactcattcgcatcattacacaagaaacaatgtggcaa
gaacagactgaatttttcatagaacatattcagaaggattatcccttattcttagatttg
actatacccgtcttgtttgggctttatttacttaagactggtcttcgaattggtttgtat
aagaagatagttttgtacttgcgaaatgaaaagactgaactgttacttaaaagtgttatt
acattcccagtgaattctaatatgatacaagaacaagcaaaatgcattggagacttcatt
atccaacacattgaagagaataagaatgtccagaacagtgaattaattaaaatagtgttg
gtcaatgttattcgagagatgtggggtgacaaagctggtgcgatgaaagtgatctcattg
ttgcttcatttgatgactacactcaaaaacgcggaagatgaagagaaaagaaagatcata
gaggaagaacaagtgacttataaatatacaactaagacgaatcaacttgctgtggatgaa
gataaagaagaagaagagtatagagcagagtttccggacttctttgctgatgttcaagac
ttattaaaaacacagagtctttcaatggaaatagaaacgaaaacgaatgaaaataagaag
aagaaggcaagagtttggatgagtgactctgatattcagtttattatgaaactcatttct
aagttactaaaagcacagaaatgccaagaaagctttgaggagatgtatgagacaaggaac
aaaatatttaaagagattttggacgagttcttcgacacaagagatctgccacttccaaag
gaatttgattgtattagttctccattccataacattttcatagacaagaaagtagctatt
ttaagtcagacgaaggcggagagaacgattgatttgaacaaagatgggagtgtttatgaa
gtcaacgaattgcttaaaaaattagaaccgttgtgtacacatgtcttgaagttgttagag
gaattcccagagaatgagatgttagtgaagatcctttctattatagagagactgaagaac
ttcccaaagacagaccctctcatgagatatttgatagtcctccacatcttgtttggtgag
cttcaaaattgggagacggtagctgcgaagtatgtttcattacgagaagaaatgaatgtg
gttgctactataatacagaagtggagatgttggcagttgaagagttgggataaaatgacg
gagagtctgaatgaagatcaactgattcaagcccgggcgtggtttgttaatgtctggaag
atggtagatgagatggtgaacaatgaagtcgacgaacaaatagaattgggctttttggaa
tcaatgaatcaatttatgtataagtgcacgtatggacaatttgaagagagacttaaagta
cttggcatagttattcaaatatgtgaatgctctgaaaatcgaaatgcacgatttgggaag
gttaaggtgatgttgacgcaaatccgggaatactacaatgtctttgtatcgagaattaaa
gaagacatagacagagagactaaacctgttgagactaaaattaaggagtttgtgaaactg
ataagatggaatgatattaaccatgaaaagatcaaagaccaagtggagaagtcgaaccgg
aaattgaatggatttaaaagggagtatgatgacattttgaagaagaatgtacaatttgtt
gttcaaagtcagacgtttgcgaacaccacgagcgctactgataaagcgttgggacccatc
tttaaagaaatacataagagtgaaaagatcaagaagactgtggattcaaagaagagaacg
gacaatatcggttatttcattaataaaattgctgtgttggaagagaataccattcgagtg
tgtgttgaagagaagatgagtaaagagaagtcgggtgttgtatggcttgaggaagtcgaa
aaagagttgattggccgtgttgtagaacttcagaatttaacaggaaaggaaggtgtgaag
acaaagaaaagagcccttttggacgcgttagaactgtttgaagtactgaagttgccacac
tcaagaaagtctgtcaaagtcgaagaagtcgttttagagagtgtgttacgaaggaactac
aaattggaaggagaagatgatgtcattaaaaacgttaacgagtatcattaccgaacttta
agtaaattggaattgtttaataagactaaagtgactccatcgagtgatttgaatgccaaa
gaaattgaatacatgcaagggtttgtctacaatttgtattccatgtgtt

DBGET integrated database retrieval system