KEGG   Entamoeba invadens: EIN_484230Help
Entry
EIN_484230        CDS       T04133                                 

Definition
(RefSeq) DnaK family protein
Organism
eiv  Entamoeba invadens
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 14888262
NCBI-ProteinID: XP_004255892
UniProt: A0A0A1U4D8
LinkDB All DBs
Position
Unknown
AA seq 442 aa AA seqDB search
NICFCSSNLKKQLIHKTGVKEINIRAVLCCPVSFNDVQKEATLRAAQYAGIDVVKLIPEP
TAAFYFYGIQKHAFNIENDITKKDTKVPTRYPKMPTEINEGIFLTFDFGGGTLDTTVAQL
KNSKITFLAVNGDPKLGGIDIDLKLTEIVKMRWKKEDENRFNTVFFVGKKLTPSNEKILK
RREYRLRKLVEKAKIALSIAQQSVVDLSEFYCGVDIDDDVKTPNIAISKEDIEIGCKNIF
QRCLNLVAQTLLESKVPKNKLTKILLVGGSSQMPYVQTLLEKEYGKIVLKDCDCNVVVAE
GAALYCRNMALHGETNVNEITCNEIEMSGVDSTNKKVVVPIIEKGTKIPFSNTFPVFPIR
NDVIVELYENKKKIGVFVIDKIQKKTKNELFECEVKINTFGILEVKCIGENRCAVNVDRE
RIQTESEDMKKKKDYIESFLSC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
aatatctgcttttgttcttcaaatttaaagaaacaactcatccataaaacgggagtcaaa
gaaattaatattcgtgccgtgttgtgctgccccgtttcgtttaatgacgtacaaaaggaa
gccactttaagggctgctcaatacgctggaatcgatgtcgtcaaattaatcccggaacca
actgctgccttctatttctatggcattcaaaaacacgcatttaacattgaaaatgatatc
accaaaaaagatacaaaagtgcctactcgataccctaaaatgccaactgaaattaatgaa
ggaatattcttgaccttcgactttggaggaggaactttggacacaaccgtcgctcaactt
aaaaattcgaagattacgtttttggcggtgaacggggatccgaaacttggaggtatcgac
atcgacttaaagttgacagaaatagtcaaaatgaggtggaaaaaagaagatgaaaataga
ttcaatactgtcttttttgttggtaagaagctcactccaagcaacgaaaagatattaaaa
cgacgcgaatatagacttcgaaaattagtggaaaaggcgaagattgctctttcaatagca
caacaaagtgttgttgatttgtcagagttttattgtggagttgatattgacgatgatgtt
aaaacaccgaacatagcaatttcaaaagaagacattgaaattggatgcaaaaatattttc
cagaggtgtttaaatcttgtcgcacaaacacttttagaatccaaagtgccaaagaacaag
ttgactaaaattctgttagtaggaggcagttcacaaatgccgtatgtgcaaacgctactt
gagaaagaatacggcaaaatagttttaaaggattgcgactgtaatgtagtagtggctgaa
ggagctgctctatattgtcgcaatatggcacttcatggggaaacaaatgtgaatgaaatt
acatgtaacgaaattgaaatgagcggagtggatagtactaacaagaaggtggtggtacca
attattgaaaagggaacaaaaattccttttagtaacacgttccccgtttttcccattaga
aatgacgtgattgtcgaattgtatgaaaacaagaagaaaatcggcgtgttcgtaattgat
aagattcagaaaaagaccaaaaatgagttgttcgaatgcgaagttaaaatcaatacattt
ggtattctggaggtaaaatgtatcggggaaaacagatgtgcagtgaatgttgacagagag
aggatacagaccgaatccgaagatatgaaaaagaaaaaagattacatcgagtcgttctta
agttgctga

DBGET integrated database retrieval system