KEGG   Entamoeba invadens: EIN_509070Help
Entry
EIN_509070        CDS       T04133                                 

Definition
(RefSeq) midasin, putative
  KO
K14572  midasin
Organism
eiv  Entamoeba invadens
Pathway
eiv03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    EIN_509070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eiv03009]
    EIN_509070
Ribosome biogenesis [BR:eiv03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    EIN_509070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_5 AAA_lid_7 Dynein_heavy
Motif
Other DBs
NCBI-GeneID: 14891821
NCBI-ProteinID: XP_004259657
UniProt: A0A0A1UFR2
LinkDB All DBs
Position
Unknown
AA seq 984 aa AA seqDB search
MKKGEMFLIDEINMAEDSVLERINSVLEPSRMMTIAEKTSTEIEEVVANDTFRIFGTMNP
GGDFGKRELSPVMRNRFTEIYVKSFEAEGDLLLIVQQKINEPTEKKFAAAIVKFLMWAEK
KFGKKVSVRNCLAWTDFMNCCTSIPSPLVRFIHAAHLVVIDGVKDEVGKTNVEYLIALNE
ALVTIGENLEDSIVQEMSMQPTLSVGPNNINVSDFTIGANGPIQKQDNYSVNTPITTNNI
FHLLRAMVLHKSILMEGSPGNQSVEHTDISDLLGTDLPLEGSSGGFGWCDRLLLRTIKVD
HGCDSMNSTWLHKVYWKVLIRCWITEQLLFASQNPLGEGSGRKGLPQSSINRFTSVYVNK
MTESDLKLIVEKMYPMIPVELRESLIDFVGQLENQVCCKKKFGRRGEPWEFNLRDVLRYC
KLYSEYSQRIDTDTVKRNMDTLGFIFTEIFKGRFRDVVDIQKVEELWRSCLSPKYKEMSM
EYHNDIHITPERFIIGEVEVSRTVNRDTTNSDKYILPTHVESMKQVMKGINHNWLISLIG
DSHCGKATLVRNVAQLCGSVLKEFSMNTSVDTIDLIGGYEQLDFERHRKSFLEDLRDYMK
LVTNKEALSIYSTLERCTKVSEIDRKHDCIFSSTEMNIIKGLIKVLNDEYLQSEITRIEV
TQQKKSIGSFEWVDGIVVKCMKRGYWLLMENVNFCNPTVLDRLNSLFEPNGYLVLNERGV
DSNGIPIIVKPHNNFRVIFTSNSMNGEISRAMRNRALELYVPQIREIDAQRMLTGFGVSL
QTAKRMIAIHLKTENMMFLYLMRWAKYVGKNGESAMKEGFDIFYVQTKSDVNEQEKLRNI
YMNQQDIECNEYESVVFKLFAQAKIGNLNVFEENVSIGDLVNQMSQIIPLICDQVPQNVM
EFDCFSLKIVIVNTLKDVKFESTMKYKEYISMVLYLLDDIDRVNYLSLLQSIEGGENIIV
YIQNENLIRQYSSRQIRGMYALYW
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagggggagatgtttttgattgatgaaattaatatggcggaggattctgtcttg
gaaagaatcaattcagtgttagaaccttcaagaatgatgaccattgcagagaagacgtca
acagagatagaagaagttgttgcgaatgatactttcagaatctttggaacaatgaacccc
ggtggagactttggtaaaagagagctgagtcctgttatgagaaaccgatttacagagatc
tatgtcaagtcgtttgaagcagaaggagacttgttactgattgtccaacagaagatcaat
gaaccaacagagaagaagtttgcggctgctatagtcaagttcttgatgtgggcggagaag
aaatttgggaagaaagtgtcagtcagaaattgcctagcgtggactgattttatgaattgt
tgtacgagtataccatcacctcttgttcgattcatccatgcagctcatttagtagtgatt
gatggtgttaaggatgaagtagggaaaacaaatgtggagtatttgatagcattgaatgag
gcattggtgactattggagagaatttggaagactctatagttcaagagatgtcgatgcaa
ccaactttgagtgttggaccaaacaacatcaatgtatcagacttcactatcggagcaaat
ggtccaattcaaaaacaagacaattacagtgtgaatacaccaattactactaacaacata
tttcatttattgagagcgatggtactccataaatcgatattaatggaaggatctcctgga
aatcaatctgtcgaacacacggacattagcgatttacttggaacggatctcccacttgaa
ggaagtagtggaggatttggatggtgtgatagattgttactgagaactatcaaagttgat
catgggtgtgactcgatgaactcaacttggcttcacaaagtgtattggaaggtcttaatt
cgttgttggatcaccgagcaactactgtttgcaagtcagaatccacttggagaagggagt
ggaagaaagggattgccacaatcgtctataaaccgatttacatcagtgtatgtcaataag
atgactgaaagtgatttgaaattgattgtcgagaaaatgtatccaatgattccagtcgaa
ctgagagagagtcttatagactttgtggggcaacttgagaatcaagtgtgctgtaaaaag
aaatttgggagacgtggagagccgtgggaattcaatttgagagatgttttgagatactgt
aaattgtattcggaatattcacaacgtattgatactgatacagtgaaaagaaatatggac
acacttgggtttatattcactgaaatctttaagggaagatttagagatgttgttgatata
caaaaagtcgaagagctctggagaagttgcttgtcaccaaaatacaaagagatgtcgatg
gaatatcacaatgatattcacatcactccggagagatttattattggagaagtggaggtg
tcgagaactgttaatagagatacaacaaactcagacaaatatatattaccaacacatgtt
gaatcgatgaaacaagtcatgaagggtattaatcataactggctcatatcacttattgga
gactcacattgtggaaaggcgacgttagtgaggaatgttgctcaactatgtggaagtgtt
ttaaaagagttttcgatgaacacaagtgttgacacgatagatctcattggtggatatgaa
caactcgattttgaaagacacagaaaatcatttttggaagaccttcgagattacatgaaa
ttggttacaaacaaggaagcgttatcaatctattcgacattggagaggtgtactaaagtg
tctgaaattgataggaaacatgattgtatcttctcatcaactgaaatgaatatcattaaa
gggttaattaaagtacttaacgatgaatatctccagtctgaaataacacgaatagaagtg
acacaacagaagaagtcgattggttcatttgaatgggtggatggtattgtagtgaagtgt
atgaaacgtgggtactggttgttaatggaaaatgtcaatttctgtaacccgactgtactt
gacagacttaattcactctttgaaccaaatgggtacttagtgttaaatgaacgcggtgta
gatagtaatggcattccaatcatcgtgaagccccacaacaattttagagtcatctttaca
tcaaattcgatgaatggagaaatatcacgagctatgaggaatagagcgcttgagttgtat
gtaccccaaattcgtgagatagacgcacaacgcatgttaactggatttggagtgtcttta
caaacagcgaaaaggatgatagcaatacatctaaagacggagaatatgatgtttttgtat
ttgatgagatgggcaaagtatgtcgggaagaatggagagagtgcgatgaaagagggattt
gacatcttctacgtccaaacaaaatcggacgtgaatgaacaagagaagttaagaaacatt
tacatgaatcaacaagatattgaatgtaatgagtacgagagtgttgtattcaaattgttt
gcacaagccaaaataggcaatttgaatgtgtttgaggagaacgtgtcgattggagatttg
gtgaatcaaatgtcacaaatcatcccattaatatgtgatcaagtgccacaaaatgtaatg
gaatttgactgtttttcattgaagattgtcattgttaacacattgaaagatgtcaaattt
gaatcgacgatgaagtacaaagaatacatttcaatggtgttgtatttacttgatgatatt
gatcgcgtcaattacttgagtttgttgcaaagcattgaaggtggagagaacatcattgtg
tatattcaaaacgagaacttaataagacaatattcaagtcgacaaattcgagggatgtat
gcactgtattggtaa

DBGET integrated database retrieval system