KEGG   Enterobacter kobei: BFV64_01255Help
Entry
BFV64_01255       CDS       T04686                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ekb  Enterobacter kobei
Pathway
ekb00250  Alanine, aspartate and glutamate metabolism
ekb00410  beta-Alanine metabolism
ekb00640  Propanoate metabolism
ekb00650  Butanoate metabolism
ekb01100  Metabolic pathways
ekb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BFV64_01255
   00650 Butanoate metabolism
    BFV64_01255
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BFV64_01255
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BFV64_01255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ekb01007]
    BFV64_01255
Enzymes [BR:ekb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BFV64_01255
Amino acid related enzymes [BR:ekb01007]
 Aminotransferase (transaminase)
  Class III
   BFV64_01255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOP85064
LinkDB All DBs
Position
263912..265177
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPK
VISAIEKQLHAFTHTAYQIVPYEGYVALAERINQRVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQYPNDLHGVSTN
EALKSLERIFKADIAPDQVAAIILEPVQGEGGFNIAPADFMQALRALCDTHGILLIADEV
QSGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRADVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRSAHLGHHLVEVLNKAKEHCPYIADIRAQGSMVAVEFND
PQTGQPSPEFTRLVQERALQDGLLLLSCGVYGNVIRFLYPLTIPEVQFRQALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaacgaccggcgtttgcaggcgacgccgcgcggtatcggcgtc
atgtgtaatttctatgccgataaagccgaaaatgccacggtgtgggacgtagaaggcaac
gagtatatcgacttcgccgccggcattgcggtgctgaataccggccatcgccatcccaaa
gtcatttccgctattgaaaaacaactccacgcctttacccatacggcgtaccagattgtg
ccgtatgaaggctatgtggcgctggccgagcgtatcaaccagcgcgtgcccattgatggc
ccggccaaaacggcctttttctcgacgggcgcagaagcggttgaaaacgcggttaaaata
gcccgcgcctatacccgacgtcctggcctcatcactttcggcggcgcgttccacggccgt
acttttatgaccatggcgctgactggcaaagttgcgccgtacaaactgggctttggtccg
ttccctggctcggtgtatcacgcgcagtatccaaacgatctgcacggcgtcagcacgaat
gaggcgttaaaaagcctggaacgcatctttaaagcggatatcgcaccggatcaggtcgcg
gccattattctcgaaccggttcagggggagggcggtttcaatatcgcgcctgccgatttt
atgcaggcgctgcgtgccctctgtgatacccacggtattttgctgattgccgacgaggta
caaagtggtttcgcccgtacaggcaaactgttctcgatggaacaccactgcgtgaagccg
gatctgatcactatggcgaaaagcctcgcgggtgggatgccgctctctgcggtatcgggc
cgtgccgacgtgatggacgcacctgcgccgggcgggctgggcggtacttacgcggggaac
ccgctggcgattgccgctgcgcatgcggtgctggacgtgattgatgaggaggatctctgt
acacgttctgcgcatcttggtcatcacctggtagaggtgctgaacaaagcgaaggaacac
tgtccgtatatcgccgacattcgcgcgcaaggatcgatggtggcggtagagtttaatgac
ccgcaaacgggccagccttcgccggaattcacccgcctggtacaggaacgcgcgctgcag
gacggtctgcttctgctgagctgcggcgtttacggcaacgttattcgtttcctttatccg
ctgacaatccccgaagtgcagttccgtcaagcgctggacattatctccgcctcgctgaca
cgttaa

DBGET integrated database retrieval system