KEGG   Enterobacter kobei: BFV64_08910Help
Entry
BFV64_08910       CDS       T04686                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ekb  Enterobacter kobei
Pathway
ekb00020  Citrate cycle (TCA cycle)
ekb00480  Glutathione metabolism
ekb01100  Metabolic pathways
ekb01110  Biosynthesis of secondary metabolites
ekb01120  Microbial metabolism in diverse environments
ekb01130  Biosynthesis of antibiotics
ekb01200  Carbon metabolism
ekb01210  2-Oxocarboxylic acid metabolism
ekb01230  Biosynthesis of amino acids
Module
ekb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ekb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BFV64_08910
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BFV64_08910
Enzymes [BR:ekb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BFV64_08910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AOP86463
UniProt: A0A181CZJ7
LinkDB All DBs
Position
1858068..1859318
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGKKITLQNGKINVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAKEEFGGELIDGGPWQKIKNPNTGKEIIVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMEWFEAADLIVKGMEGAINAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcggaaggtaaaaagatcaccctgcaaaacggcaag
attaacgttcctcacaatccgattatcccgttcattgaaggtgacggtatcggtgtagac
gttaccccggcaatgctgaaagtggttgatgccgctgttgagaaagcctacaaaggcgag
cgtaaaatttcctggatggaaatttacaccggtgagaaatcgactcaagtttatggccag
gacgtctggctgccagcagaaacgctggacctgatccgcgactaccgcgttgctatcaaa
ggcccattgaccaccccagtcggcggcggtatccgctccctgaacgtggcactgcgtcag
gagctggacctgtacgtctgtctgcgtccggtgcgttactatcagggcaccccaagcccg
gttaagcaccctgaactgaccgatatggttatcttccgcgaaaactcagaagacatctac
gcgggcatcgagtggaaagcagactctgcagacgcagaaaaagtgattaaattcctgcgc
gaagagatgggcgtgaagaaaattcgcttccctgaacattgcggtatcggcatcaagcca
tgctccgaagaagggactaaacgtctggtgcgcgcggctatcgaatacgcgatcaccaac
gaccgtgactctgtgactctggttcacaaaggcaacatcatgaagttcaccgaaggtgcc
ttcaaagactggggttaccagttggcgaaagaagagttcggcggtgagctgatcgacggt
ggcccgtggcagaagatcaagaacccgaacaccggcaaagagatcatcgttaaagatgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtcctgctgaatacgacgtgattgcc
tgtatgaacctgaacggtgactacatctctgacgccctggcagcacaggttggcggtatc
ggtatcgcccctggtgcaaacatcggtgacgagtgcgctctgttcgaggcgacccacggt
actgctcctaaatatgcaggtcaggacaaagtgaacccaggctctatcatcctgtccgca
gagatgatgctgcgtcatatggaatggttcgaagccgcagacctgatcgttaaaggtatg
gaaggcgcgatcaacgcgaaaaccgtaacttacgatttcgaacgtctgatggaaggcgct
aaactgctgaaatgctcagagtttggcgacgcgatcatcgcgaacatgtaa

DBGET integrated database retrieval system