KEGG   Enterobacter kobei: BFV64_09760Help
Entry
BFV64_09760       CDS       T04686                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ekb  Enterobacter kobei
Pathway
ekb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ekb00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BFV64_09760
Enzymes [BR:ekb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BFV64_09760
Transporters [BR:ekb02000]
 Other Transporters
  Pores ion channels [TC:1]
   BFV64_09760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_N_2 GST_C_3 GST_N_3 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: AOP86620
UniProt: A0A0F0XS18
LinkDB All DBs
Position
complement(2025617..2026222)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFLAINPKGQVPALLLDDG
TLLTEGVAIMQFLADNVPDRQLLAPTGSIARYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTLRALLEKKLQYVNASLKDDQWICGSRFTIADAYLFTVLRWARAVKLNMEGLDHITS
YMTRMAERPAVAAALKAEGLS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcgtgctctcttgcttcccatatcaccctgcgcgag
agcggcaaagatttcacgctcgatggcgttgatctgatgaaaaagcgtctggagaatggc
gatgatttccttgccattaacccgaagggacaagttccagcgctgttgctggatgacgga
actctgctgacagaaggcgttgccatcatgcaattcctggcggacaacgtaccggatcgc
cagcttcttgcccccaccggcagcattgcacgctataagaccctggagtggttaaactat
atcgctaccgagttacataaaggctttactcccctgttccgcccggatacgccggaagag
tacaaaccgaccctgcgcgcgcttcttgagaaaaagctgcagtatgtaaacgcgtcgctg
aaagacgatcagtggatttgtggttcccgtttcacgattgccgatgcctatctgtttacc
gtgctgcgctgggcacgggcggttaagctcaatatggaagggttagaccatattacatcg
tatatgacccgtatggcggagcgtcctgcggtggctgcggcgctgaaagcggaaggtctt
agctaa

DBGET integrated database retrieval system