KEGG   Enterobacter kobei DSM 13645: BFV64_20615
Entry
BFV64_20615       CDS       T04686                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ekb  Enterobacter kobei DSM 13645
Pathway
ekb00052  Galactose metabolism
ekb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ekb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BFV64_20615
Enzymes [BR:ekb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     BFV64_20615
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_31 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N MTS Methyltransf_25 PrmA ELFV_dehydrog Shikimate_DH 3HCDH_N ThiF
Other DBs
NCBI-ProteinID: AOP88603
LinkDB
Position
4257819..4258862
AA seq 347 aa
MKSVVIHAEGSVRVEERPIPQIQDADEVLVRIVCSGLCGSDIPRIFAKGAHYYPIILGHE
FSGHVEACGADVKDLQAGDAVACIPLLPCFSCPECGQGYYSLCKQYQFVGSRSDGGNAEY
IVVKRANLFRLPAEMAIEDGAFIEPVTVGLHAFHLASGCKGKNVIIVGAGTIGLLAMQCA
LALGAKSVTAIDINDDKLALAKTLGATHVFNSRTLSTDDILNAQSDSRFDQLVLETAGTP
QTVSLAIDIAGPHAQVALVGTLHHDLNLSAATFGKILRKELTLLGSWMNYSAPWPGEEWE
TAVRLLTGKKLQLEPLIAHTGDSESFAQAVQALNGAPMQGKIMLRFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaattcacgctgagggcagcgtgcgcgttgaagaacgtccgatccct
caaatacaggatgcggatgaagttctggtgcgcattgtttgctcagggttatgcggctca
gatatcccgcgtatttttgccaaaggggcacactattatcctatcatccttggccatgaa
tttagcggacacgtcgaagcctgtggtgcagatgtaaaggacctccaggcgggagatgct
gtggcctgcattccacttctgccctgtttttcctgcccagagtgtgggcaaggctactac
tcgctgtgtaagcagtaccagtttgtcggctcacgcagtgacggtggcaatgccgaatat
attgtcgtgaagcgcgcgaacttgttccgcctgccagcagagatggcaatcgaagacggg
gcatttatcgaacctgtcaccgtaggtttgcacgcgtttcatctggcttcaggctgcaaa
ggtaaaaatgtcattatcgtcggagcggggacgatcggtctgctggcgatgcagtgcgcg
ttggcgctcggggcaaagagcgtaactgcgattgatatcaacgacgataaactcgccctg
gcgaaaacactgggtgcgactcatgtattcaacagccgtaccttgagcaccgatgacatt
ctcaacgcgcagagtgacagtcgatttgatcaactggtgctggagaccgcaggaacacca
caaactgtctcgcttgccattgatattgctggccctcacgcacaagttgcgctggtcggt
acattgcatcatgacctgaatttatctgccgcaacctttggcaaaatattacgtaaggaa
ctgacgcttttgggtagctggatgaactactctgcaccgtggccaggggaagagtgggaa
acagcagtccgcctgctcaccgggaaaaaactgcaactggagccgctcattgctcatact
ggcgacagtgaaagcttcgctcaggccgtgcaggcactgaatggggcaccgatgcagggc
aaaattatgctgcgtttcgcctaa

DBGET integrated database retrieval system